NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105745

Metagenome / Metatranscriptome Family F105745

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105745
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 40 residues
Representative Sequence MSAGTQQVPIPWTPAPPQLVMAYSVCKGITRTAAKNFYYAF
Number of Associated Samples 86
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 91.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.00 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.000 % of family members)
Environment Ontology (ENVO) Unclassified
(32.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(53.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00494SQS_PSY 91.00
PF00107ADH_zinc_N 3.00
PF02606LpxK 1.00
PF08240ADH_N 1.00
PF02463SMC_N 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG1562Phytoene/squalene synthetaseLipid transport and metabolism [I] 91.00
COG1663Tetraacyldisaccharide-1-P 4'-kinase (Lipid A 4'-kinase)Cell wall/membrane/envelope biogenesis [M] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.00 %
UnclassifiedrootN/A9.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004091|Ga0062387_100129076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1418Open in IMG/M
3300004479|Ga0062595_100870192All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300005177|Ga0066690_10373817All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter967Open in IMG/M
3300005529|Ga0070741_11051500All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter695Open in IMG/M
3300005532|Ga0070739_10541495All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300005541|Ga0070733_10251879All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1161Open in IMG/M
3300005602|Ga0070762_10160971All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1350Open in IMG/M
3300005610|Ga0070763_10144295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1238Open in IMG/M
3300006162|Ga0075030_101320143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae566Open in IMG/M
3300006162|Ga0075030_101537797All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300006162|Ga0075030_101659089All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300006173|Ga0070716_100609382All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300006176|Ga0070765_101159652All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300009521|Ga0116222_1118502All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300009665|Ga0116135_1287968All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300010043|Ga0126380_12150481All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300010366|Ga0126379_10846392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Chthonomonadetes → Chthonomonadales → unclassified Chthonomonadales → Chthonomonadales bacterium1015Open in IMG/M
3300010366|Ga0126379_13479666All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300010376|Ga0126381_100700286Not Available1449Open in IMG/M
3300010376|Ga0126381_102725222Not Available706Open in IMG/M
3300010379|Ga0136449_100678711All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.1734Open in IMG/M
3300010379|Ga0136449_101011211All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300011120|Ga0150983_15717262All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300012203|Ga0137399_10150867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1856Open in IMG/M
3300012207|Ga0137381_11407609All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012361|Ga0137360_11288612All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300014169|Ga0181531_10348549All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300014201|Ga0181537_10598482All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300014489|Ga0182018_10722394All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300014654|Ga0181525_10592889All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300014654|Ga0181525_10799780All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300014654|Ga0181525_10869236All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300015371|Ga0132258_10256512All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4278Open in IMG/M
3300016294|Ga0182041_11480905All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300017823|Ga0187818_10163296All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300017823|Ga0187818_10275972All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300017936|Ga0187821_10229180All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300017995|Ga0187816_10206241All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300018024|Ga0187881_10165481All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300018085|Ga0187772_10697377Not Available728Open in IMG/M
3300018086|Ga0187769_11206298All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300018090|Ga0187770_10418141All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300019786|Ga0182025_1055666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Chthonomonadetes → Chthonomonadales → unclassified Chthonomonadales → Chthonomonadales bacterium862Open in IMG/M
3300020150|Ga0187768_1101206All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300020580|Ga0210403_10278326All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1372Open in IMG/M
3300020581|Ga0210399_10766891All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300021180|Ga0210396_10043819All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4111Open in IMG/M
3300021402|Ga0210385_11137040All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300021432|Ga0210384_11166294All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300021433|Ga0210391_10467111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Chthonomonadetes → Chthonomonadales → unclassified Chthonomonadales → Chthonomonadales bacterium990Open in IMG/M
3300021475|Ga0210392_11398770All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300021560|Ga0126371_11208201Not Available892Open in IMG/M
3300022523|Ga0242663_1089260All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300022724|Ga0242665_10249308All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300024225|Ga0224572_1083262All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300024331|Ga0247668_1088155All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300025414|Ga0208935_1024051All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300025612|Ga0208691_1036340Not Available1131Open in IMG/M
3300025910|Ga0207684_10142203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2063Open in IMG/M
3300025929|Ga0207664_10316607All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1376Open in IMG/M
3300027565|Ga0209219_1153594All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300027629|Ga0209422_1047114Not Available1039Open in IMG/M
3300027698|Ga0209446_1078302All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300027768|Ga0209772_10205380Not Available624Open in IMG/M
3300027889|Ga0209380_10327552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis899Open in IMG/M
3300027889|Ga0209380_10335666All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300027898|Ga0209067_10821835All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300027986|Ga0209168_10417279All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300028036|Ga0265355_1001695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1468Open in IMG/M
3300028047|Ga0209526_10211947All Organisms → cellular organisms → Bacteria1338Open in IMG/M
3300028566|Ga0302147_10266760All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300028906|Ga0308309_11346911All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300028906|Ga0308309_11659542All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300029943|Ga0311340_10564572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → Chthonomonadetes → Chthonomonadales → unclassified Chthonomonadales → Chthonomonadales bacterium1002Open in IMG/M
3300029943|Ga0311340_11146731All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300030044|Ga0302281_10381022Not Available547Open in IMG/M
3300030503|Ga0311370_11510809All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300030629|Ga0210268_1134169All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300030687|Ga0302309_10002260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae16282Open in IMG/M
3300030991|Ga0073994_11979612All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300031231|Ga0170824_128106495All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300031234|Ga0302325_11961703All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300031236|Ga0302324_102293376All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300031708|Ga0310686_105489659All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300031708|Ga0310686_110809808All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300031715|Ga0307476_11261246All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300031718|Ga0307474_10864191All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300031754|Ga0307475_10533794All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300031823|Ga0307478_10247593All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1447Open in IMG/M
3300031823|Ga0307478_10693012All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300031962|Ga0307479_10869473All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300032160|Ga0311301_10739948All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1369Open in IMG/M
3300032174|Ga0307470_11443155All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300032174|Ga0307470_11584581All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300032180|Ga0307471_100079355All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2878Open in IMG/M
3300032515|Ga0348332_11537299All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300032770|Ga0335085_11028237Not Available888Open in IMG/M
3300032892|Ga0335081_10320517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2039Open in IMG/M
3300032955|Ga0335076_10199750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1902Open in IMG/M
3300034163|Ga0370515_0294852All Organisms → cellular organisms → Bacteria686Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil9.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil7.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.00%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.00%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.00%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.00%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.00%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.00%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020150Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024225Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5Host-AssociatedOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027629Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028036Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2Host-AssociatedOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028566Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030629Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030687Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062387_10012907613300004091Bog Forest SoilVSAGTQQVPIPWTPAPPQLVMAYSVCKGITRTAAKNFYYAFLVL
Ga0062595_10087019223300004479SoilMSVGTQQVPVPWTPAPPQLVMAYSVCKGITRTAAKNFYYAFLV
Ga0066690_1037381723300005177SoilMSAGAQQVFMPWTPAPAQLAMAYSVCRGITRTNAKNFYYAF
Ga0070741_1105150013300005529Surface SoilMSVGTQQVPVPWTPAPPQLVMAYSVCKGITRTAAKNFYY
Ga0070739_1054149523300005532Surface SoilMSAGTQQVPVPWTPAPPQLVMAYSVCKGITRMAAKNFY
Ga0070733_1025187923300005541Surface SoilMSAGAQPVLIPWTPAPAQLHMAYSVCRGITRAKAKNFYYAFLV
Ga0070762_1016097133300005602SoilMSAGAQPVMIPWTPAPAQLTMAYSVCRGITRTNAKNFYYAFLVL
Ga0070763_1014429523300005610SoilMSAGAQQVMIPWSPAPAQLSMAYSVCSGITRSNAKNFYY
Ga0075030_10132014313300006162WatershedsMSVGAQQVPAPWTPAPPQLVMAYSVCKGITRTAAKNFYYAFLVL
Ga0075030_10153779713300006162WatershedsLSAGTQQIPIPWIPAPKQLVMAYSVCRGITRTAAKNFYY
Ga0075030_10165908913300006162WatershedsLSAGTQQVPVPWTPAKPQLVMAYSVCRGITRTAAKN
Ga0070716_10060938223300006173Corn, Switchgrass And Miscanthus RhizosphereMSAGTQQVPLPWTPAPPQLVMAYSVCKGITRQNAKNFYYG
Ga0070765_10115965213300006176SoilMSAGAQQMMIPWTPAPAQLTMAYSVCRGITRTNAKNFY
Ga0116222_111850213300009521Peatlands SoilMSAGAQPILVPWTPAPAQLTMAYSVCRGITRTNAKNFYYAFL
Ga0116135_128796813300009665PeatlandMSAGAQPVFIPWTPAPAQLTIAYSVCRGITRTNAKNFYYA
Ga0126380_1215048113300010043Tropical Forest SoilMSASTQPVSAAWTPAPPQLVMAYSVCKGITRVAAKNFYYAFLVL
Ga0126379_1084639223300010366Tropical Forest SoilMSVGTQPVAVPWTPAPPQLVMAYSVCKGITRVAAKNFYYAFLVL
Ga0126379_1347966613300010366Tropical Forest SoilMNASARQIPVPWTPAPPQLGMAYAVCKDITRRAAKNFYYAFL
Ga0126381_10070028613300010376Tropical Forest SoilMSAGAQQVPIPWTPAPPQLVMAYSVCKGITRRNAKNFYYGF
Ga0126381_10272522223300010376Tropical Forest SoilMSVSAPQIPAPWTPAPPQLVMAYSVCKGITRVAARNFYYAFL
Ga0136449_10067871113300010379Peatlands SoilMSAGTQQVPMPWTPAPPQLVMAYSVCKGITRTAAKNFYYAFLVL
Ga0136449_10101121113300010379Peatlands SoilMSAGAQPILVPWTPAPAQLTMAYSVCRGITRTNAKNFYYAFLV
Ga0150983_1571726213300011120Forest SoilMSAGAQQVLIPWSPAPAQLTMAYSVCRGITRTNAKNFYYAFLV
Ga0137399_1015086713300012203Vadose Zone SoilMSAGAQQVFIPWTPAPAQLAMAYSVCRGITRTNARNFYYAFLV
Ga0137381_1140760913300012207Vadose Zone SoilMSAGTQQVPIPWTPAPPQLVMAYSVCKGITRTAAKNFYYAF
Ga0137360_1128861213300012361Vadose Zone SoilMSAGAQQVLIPWTPAPAQLQMAYSVCRGITRTNAKNFYYA
Ga0181531_1034854913300014169BogVSAGTHQVPIPWTPAPPQLVMAYSVCKGITRTAAKNFYYA
Ga0181537_1059848223300014201BogMSVGAQQVSIPWTPAPPQLVMAYSVCKGITRAAAK
Ga0182018_1072239423300014489PalsaMSAGAQPVLIPWSPAPAQLTMAYSVCRGITRTNAKNFYYAF
Ga0181525_1059288913300014654BogVSAGAQQVPIPWSPAPAQLTMAYSVCRGITRTNAKNFYY
Ga0181525_1079978013300014654BogMSASAQQAAVPWTPAPAQLVMAYSVCRGITRTAAKN
Ga0181525_1086923613300014654BogVSAGTHQVPIPWTPAPPQLVMAYSVCKGITRTAAKNFYYAFLVLP
Ga0132258_1025651213300015371Arabidopsis RhizosphereVSAGTQPVPMPWTPAPPQLVMAYSVCKGITRMAAKNFYYAF
Ga0182041_1148090513300016294SoilMSASAQQVPVPWTPAPPQLVMAYSVCKGITRVAAKNFYYAFLVLPRG
Ga0187818_1016329623300017823Freshwater SedimentMSAGTQQVPIPWSPAPPQLVMAYSVCKGITRTAAKNFYYAF
Ga0187818_1027597223300017823Freshwater SedimentMSAGTQQVPIPWTPAPPQLVMAYSVCKGITRTAAKNFYYAFL
Ga0187821_1022918013300017936Freshwater SedimentMSVGTQQVPMPWTPAPPQLVMAYSVCKGITRTAAKNFYY
Ga0187816_1020624123300017995Freshwater SedimentMSAGTQQVPMPWTPAPPQLVMAYSVCKGITRTAAKNFYYAF
Ga0187881_1016548113300018024PeatlandMSAGAQPVMVPWSPAPAQLTMAYSVCRGITRTNAKN
Ga0187772_1069737723300018085Tropical PeatlandMSAGTQQIPIPWTPAPPQLVMAYSVCKGITRRAAKNFYY
Ga0187769_1120629823300018086Tropical PeatlandMSAGLQPATVPWTPAPPQLVMAYSVCRGITRAAAKNFYYAF
Ga0187770_1041814113300018090Tropical PeatlandMSAGTQQVPVSWTPAAPQLAMAYSVCRGITRTAAKNFYYAF
Ga0182025_105566613300019786PermafrostMSAGAQPVLIPWSPAPAQLHMAYSVCRGITRAQRQK
Ga0187768_110120623300020150Tropical PeatlandMSAGTQQIVAPWTPAPPQLVMAYSVCRGITRSAAKNFYYAFLV
Ga0210403_1027832633300020580SoilMSAGTQPVPMPWTPAPPQLVMAYSVCKGITRLAAKNFY
Ga0210399_1076689113300020581SoilMTASAQPAFVPWTPAPPQLVMAYSVCKGITRTAAKN
Ga0210396_1004381953300021180SoilMSAGTQPVPMPWTPAPPQLVMAYSVCKGITRVAAKNFY
Ga0210385_1113704013300021402SoilMSAGTQQMPIPWTPAPPQLVMAYSVCKGITRTAAKNFYYAFLVLP
Ga0210384_1116629423300021432SoilMSAGTQQVPIPWTPAPPQLVMAYSVCKGITRTAAKNFYY
Ga0210391_1046711123300021433SoilVSAGTHQVPIPWTPAPPQLVMAYSVCKGITRTAAKNFYYAF
Ga0210392_1139877013300021475SoilMSAGTQQVAGPWTPAPPQLVMAYSVCKGITRAAAKNFYYAFL
Ga0126371_1120820113300021560Tropical Forest SoilMMSAGTQQVPIPWTPAPPQLVMAYSVCKGITRQNAKNFY
Ga0242663_108926013300022523SoilMSAGTQPVPMPWTPAPPQLVMAYSVCKGITRVAAKNFYYA
Ga0242665_1024930823300022724SoilMSAGTQQVPIPWTPAPPQLVMAYSVCKGITRTSAKNFYYPFLVL
Ga0224572_108326223300024225RhizosphereMSAGTQQVPIPWTPAPPQLVMAYSVCKGITRTAAKN
Ga0247668_108815523300024331SoilMSAGTQQVPLPWTPAPPQLVMAYSVCKGITRQNAKNFYYGFLVLPR
Ga0208935_102405113300025414PeatlandVMMPWSPAPAQLTIAYSVCRGITRSNAKNFYYAFL
Ga0208691_103634023300025612PeatlandMSAGAQSAMIPWTPAPAQLTMAYSVCRGITRTSAKN
Ga0207684_1014220333300025910Corn, Switchgrass And Miscanthus RhizosphereMSAGTQQVPIPWAPAPPQLVMAYSVCKGITRTAAKNFYYAFLVLPCR
Ga0207664_1031660733300025929Agricultural SoilMSTRAQPVSASWTPAPPQLVMAYSVCKGITRVAAKNF
Ga0209219_115359413300027565Forest SoilMSAGAQQVLIPWNPAPAQLAMAYSVCRGITRTNAKNFYYAF
Ga0209422_104711413300027629Forest SoilMSAGTQQVPIPWTPAPPQLVMAYSVCKGITRTSAKNFYY
Ga0209446_107830223300027698Bog Forest SoilMSAGAQQVLIPWTPAPAQLTMAYSVCRGITRANAKNFYYAF
Ga0209772_1020538023300027768Bog Forest SoilMSTEAQPALVPWSPAPAQLTVAYSVCRGITRTNAKNF
Ga0209380_1032755233300027889SoilMSAGAQQVMIPWSPAPAQLSMAYSVCRGITRSNAKNFYYAFLV
Ga0209380_1033566613300027889SoilVSAGTQPVIVPWSPAPAQLTMAYSVCRGITRANAR
Ga0209067_1082183513300027898WatershedsMSVGAQQVPVPWTPAPPQLVMAYSVCKGITRTAAKNFYY
Ga0209168_1041727913300027986Surface SoilMSTASQPTLIPSWTPAPAQLTMAYSVCRGITRTSAKNFFYAFHVL
Ga0265355_100169513300028036RhizosphereMSASVQQAAVPWTPAPAQLVMAYSVCRGITRTAAKNFYYA
Ga0209526_1021194713300028047Forest SoilMSAGTQQVPIPWTPAPPQLVMAYSVCKGITRTAAKNFYYAFLVLP
Ga0302147_1026676023300028566BogMSAGAQQVLIPWTPAPAQLTMAYSVCRGITRTNARNFYYAFLV
Ga0308309_1134691113300028906SoilMSVGAQPVSIPWNPAPAQLTMAYSVCRGITRTNAKNFYYAFLV
Ga0308309_1165954213300028906SoilMSVGTQPVLIPWSPAPAQLTMAYSVCRGITRANAKNFYYA
Ga0311340_1056457223300029943PalsaMSVGAQPVSIPWNPAPAQLTMAYSVCRGITRTNAKNFYYA
Ga0311340_1114673113300029943PalsaMSAGTQQAMVAWTPAPRQLVMAYSVCRGITRTAAK
Ga0302281_1038102223300030044FenMSSASQPALIPSWTPAPAQLAMAYSVCRGITRSNAKNF
Ga0311370_1151080923300030503PalsaMSAGAQPVSIPWSPAPAQLTMAYSVCRGITRTNAKN
Ga0210268_113416923300030629SoilMSAGTQPVLIPWSPAPAQLTMAYSVCRGITRANAKNFYYAFLV
Ga0302309_10002260183300030687PalsaMSAGAQPVLIPWSPAPAQLHMAYSVCRGITRANAKNFYYAFL
Ga0073994_1197961223300030991SoilMSAGTQQVPIPWTPAPPQLVMAYSVCKGITRTAAK
Ga0170824_12810649523300031231Forest SoilMSVGAQQVPVPWTPAPPQLVMAYSVCKGITRVAAKNFYYAFLVR
Ga0302325_1196170323300031234PalsaMSASAQQATVPWTPAPAQLVMAYSVCRGITRTAAKNFYYAFL
Ga0302324_10229337613300031236PalsaMSAGVQPALIPWNPAPAQLTMAYSVCRGITRSNAKN
Ga0310686_10548965923300031708SoilLSAGTQQVPTPWTPAPPQLVMAYSVCRGITRTAAKNF
Ga0310686_11080980813300031708SoilMTAGAQPVFIPWTPAPAQLTMAYSVCRGITRSNAKNFYY
Ga0307476_1126124623300031715Hardwood Forest SoilMSAGTQPVLIPWSPAPAQLTMAYSVCRGITRANAKNFY
Ga0307474_1086419123300031718Hardwood Forest SoilMSAGAQSALIPWNPAPAQLTMAYSVCRGITRSNAKNFYYAFLV
Ga0307475_1053379413300031754Hardwood Forest SoilMSAGAQQVLIPWTPAPAQLQMAYAVCRGITRTNAKNF
Ga0307478_1024759313300031823Hardwood Forest SoilMSAGTQPVPMPWTPAPPQLVMAYSVCKGITRVAAKNF
Ga0307478_1069301213300031823Hardwood Forest SoilMSAGAQQAAMPWTPAPPQLAMAYSVCRGIARSAAKNFYYA
Ga0307479_1086947313300031962Hardwood Forest SoilMSAGAQPVLIPWTPAPAQLTMAYSVCRGITRTNAKNF
Ga0311301_1073994833300032160Peatlands SoilMSAGAQPILVPWTPAPAQLTMAYSVCRGITRTNAKNFYY
Ga0307470_1144315513300032174Hardwood Forest SoilMSAGAQQVLTGWTPAPAQLTMAYSVCRGITRTNAKNF
Ga0307470_1158458123300032174Hardwood Forest SoilMSAGAQPVLIPWTPAPAQLTMAYSVCRGITRANAKKFYYAFLVL
Ga0307471_10007935513300032180Hardwood Forest SoilMSAGAQQVLTGWTPAPAQLTMAYSVCRGITRTNAKNFYYAF
Ga0348332_1153729923300032515Plant LitterMSAGAQPVLLPWSPAPAQLTMAYSVCRGITRANAK
Ga0335085_1102823723300032770SoilMSAGTQQVPLPWTPAPPQLVMAYSVCKGITRTAAK
Ga0335081_1032051733300032892SoilMTAGTQPVPLRWTPAPPQLVMAYSVCKGITRTAAKN
Ga0335076_1019975033300032955SoilMSAGTQQVPLPWTPAPPQLVMAYSVCKGITRQNAKNFY
Ga0370515_0294852_3_1253300034163Untreated Peat SoilMSAGAQQVMIPWTPAPAQLTIAYAVCRGITRTNAKNFYYAF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.