| Basic Information | |
|---|---|
| Family ID | F105734 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 39 residues |
| Representative Sequence | LDGTSRELTDMLAAADAALYYAKETGRNKTHVIPASAQAS |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.00 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF13522 | GATase_6 | 32.00 |
| PF00990 | GGDEF | 4.00 |
| PF03965 | Penicillinase_R | 1.00 |
| PF11209 | LmeA | 1.00 |
| PF14417 | MEDS | 1.00 |
| PF00400 | WD40 | 1.00 |
| PF12399 | BCA_ABC_TP_C | 1.00 |
| PF00310 | GATase_2 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.00 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.00 % |
| Unclassified | root | N/A | 18.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_104244401 | Not Available | 752 | Open in IMG/M |
| 3300001356|JGI12269J14319_10061487 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100593383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 985 | Open in IMG/M |
| 3300003368|JGI26340J50214_10187916 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300004082|Ga0062384_100942142 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300005591|Ga0070761_10641245 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300005719|Ga0068861_101225432 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005764|Ga0066903_103566260 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300006173|Ga0070716_100754968 | Not Available | 749 | Open in IMG/M |
| 3300006175|Ga0070712_101782549 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300009089|Ga0099828_10539937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1051 | Open in IMG/M |
| 3300009137|Ga0066709_102327508 | Not Available | 733 | Open in IMG/M |
| 3300009148|Ga0105243_10406713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1266 | Open in IMG/M |
| 3300009525|Ga0116220_10277805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia niigatensis | 734 | Open in IMG/M |
| 3300009525|Ga0116220_10586123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
| 3300009672|Ga0116215_1427938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300009683|Ga0116224_10153589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1108 | Open in IMG/M |
| 3300009698|Ga0116216_10573929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300009700|Ga0116217_10538334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
| 3300009824|Ga0116219_10268180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 967 | Open in IMG/M |
| 3300010343|Ga0074044_10610514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 712 | Open in IMG/M |
| 3300010359|Ga0126376_12586149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
| 3300010373|Ga0134128_10613585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1210 | Open in IMG/M |
| 3300010396|Ga0134126_12889246 | Not Available | 520 | Open in IMG/M |
| 3300012354|Ga0137366_10749834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia jejuensis | 694 | Open in IMG/M |
| 3300012359|Ga0137385_10746606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 815 | Open in IMG/M |
| 3300012473|Ga0157340_1027000 | Not Available | 517 | Open in IMG/M |
| 3300014654|Ga0181525_10415816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 739 | Open in IMG/M |
| 3300014745|Ga0157377_11158791 | Not Available | 596 | Open in IMG/M |
| 3300015242|Ga0137412_10467196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 969 | Open in IMG/M |
| 3300016357|Ga0182032_10149744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1725 | Open in IMG/M |
| 3300017823|Ga0187818_10163948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia crassostreae | 968 | Open in IMG/M |
| 3300017926|Ga0187807_1257243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300017955|Ga0187817_11099718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300017970|Ga0187783_10058075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2852 | Open in IMG/M |
| 3300017972|Ga0187781_10420496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 955 | Open in IMG/M |
| 3300017972|Ga0187781_11047107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300018012|Ga0187810_10232628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
| 3300018060|Ga0187765_11377163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300018062|Ga0187784_10152865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1885 | Open in IMG/M |
| 3300018482|Ga0066669_10043901 | Not Available | 2768 | Open in IMG/M |
| 3300020579|Ga0210407_10611604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
| 3300021171|Ga0210405_11016611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
| 3300021403|Ga0210397_10844202 | Not Available | 708 | Open in IMG/M |
| 3300021405|Ga0210387_11536557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300021406|Ga0210386_10390079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1199 | Open in IMG/M |
| 3300021433|Ga0210391_11493572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
| 3300021478|Ga0210402_10112147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2458 | Open in IMG/M |
| 3300024176|Ga0224565_1048242 | Not Available | 501 | Open in IMG/M |
| 3300024245|Ga0247677_1043699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
| 3300025315|Ga0207697_10564328 | Not Available | 500 | Open in IMG/M |
| 3300025527|Ga0208714_1089070 | Not Available | 620 | Open in IMG/M |
| 3300025633|Ga0208480_1002065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7140 | Open in IMG/M |
| 3300025909|Ga0207705_10649567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 820 | Open in IMG/M |
| 3300025910|Ga0207684_11721072 | Not Available | 505 | Open in IMG/M |
| 3300025921|Ga0207652_11094348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300025922|Ga0207646_10382943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1271 | Open in IMG/M |
| 3300025922|Ga0207646_10759179 | Not Available | 865 | Open in IMG/M |
| 3300025929|Ga0207664_11356013 | Not Available | 631 | Open in IMG/M |
| 3300025929|Ga0207664_11741931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300025941|Ga0207711_10428870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1230 | Open in IMG/M |
| 3300027107|Ga0208367_115981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300027158|Ga0208725_1012871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1383 | Open in IMG/M |
| 3300027676|Ga0209333_1054885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1098 | Open in IMG/M |
| 3300027853|Ga0209274_10410479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 700 | Open in IMG/M |
| 3300027853|Ga0209274_10458882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 659 | Open in IMG/M |
| 3300027855|Ga0209693_10095097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1474 | Open in IMG/M |
| 3300027884|Ga0209275_10714244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 577 | Open in IMG/M |
| 3300028742|Ga0302220_10156189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis acidicola | 867 | Open in IMG/M |
| 3300028906|Ga0308309_10238178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1517 | Open in IMG/M |
| 3300030580|Ga0311355_10477372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1201 | Open in IMG/M |
| 3300031561|Ga0318528_10739918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300031572|Ga0318515_10033295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2529 | Open in IMG/M |
| 3300031680|Ga0318574_10102956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1585 | Open in IMG/M |
| 3300031680|Ga0318574_10542080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 682 | Open in IMG/M |
| 3300031708|Ga0310686_107644478 | Not Available | 606 | Open in IMG/M |
| 3300031723|Ga0318493_10297042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300031747|Ga0318502_10155831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1305 | Open in IMG/M |
| 3300031753|Ga0307477_10787121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300031777|Ga0318543_10445354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300031778|Ga0318498_10280687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
| 3300031796|Ga0318576_10560790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
| 3300031823|Ga0307478_10624722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 901 | Open in IMG/M |
| 3300031910|Ga0306923_10890897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 975 | Open in IMG/M |
| 3300031946|Ga0310910_11044214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
| 3300031946|Ga0310910_11551133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300031981|Ga0318531_10588916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300032043|Ga0318556_10313372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
| 3300032090|Ga0318518_10217245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 980 | Open in IMG/M |
| 3300032160|Ga0311301_10467516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1889 | Open in IMG/M |
| 3300032160|Ga0311301_11276111 | Not Available | 931 | Open in IMG/M |
| 3300032160|Ga0311301_11599536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
| 3300032261|Ga0306920_100917413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1280 | Open in IMG/M |
| 3300032261|Ga0306920_102629482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
| 3300032770|Ga0335085_10300398 | Not Available | 1903 | Open in IMG/M |
| 3300032770|Ga0335085_10434564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1514 | Open in IMG/M |
| 3300032770|Ga0335085_10548545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis acidicola | 1310 | Open in IMG/M |
| 3300032783|Ga0335079_11355664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300032829|Ga0335070_11287140 | Not Available | 669 | Open in IMG/M |
| 3300032895|Ga0335074_10020303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9365 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027107 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF029 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1042444011 | 3300000956 | Soil | GESRELTDMLAAADAALYHAKETGRNKTHVISASAPTA* |
| JGI12269J14319_100614873 | 3300001356 | Peatlands Soil | DGERRELTDMLAAADSALYYAKETGRNKTHVITATRQAS* |
| JGIcombinedJ26739_1005933833 | 3300002245 | Forest Soil | SLDGESRELTDLVAAADAALYHAKDAGRNRTHVIPASASAPAS* |
| JGI26340J50214_101879162 | 3300003368 | Bog Forest Soil | DGASRELTDLLAAADAALYYAKETGRNKTHVITSAARSS* |
| Ga0062384_1009421421 | 3300004082 | Bog Forest Soil | GVAALDGTSRELTDMLAAADAALYYAKETGRNKTHVSPASAPAS* |
| Ga0070761_106412453 | 3300005591 | Soil | VAALDGDHRQLTELLAAADAALYHAKVTGRNKTHMISSTAQVSSS* |
| Ga0068861_1012254321 | 3300005719 | Switchgrass Rhizosphere | LTSESQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP* |
| Ga0066903_1035662603 | 3300005764 | Tropical Forest Soil | SLDGENRELTDLLAAADAALYHAKETGRNKTHVISATSQTA* |
| Ga0070716_1007549685 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RELTDMLAAADAALYHAKETGRNKTHVISASAPTV* |
| Ga0070712_1017825492 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SRELTDLLAAADAALYHAKGAGRNRTHMVTANVPAS* |
| Ga0099828_105399373 | 3300009089 | Vadose Zone Soil | AALDGASRELTDMLAAADAALYYAKETGRNKTHVISATAQAS* |
| Ga0066709_1023275082 | 3300009137 | Grasslands Soil | GESRELTDLLAAADAALYHAKETGRNKTHVISATSQTA* |
| Ga0105243_104067131 | 3300009148 | Miscanthus Rhizosphere | QELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP* |
| Ga0116220_102778053 | 3300009525 | Peatlands Soil | RELTDMLAAADSALYYAKETGRNKTHVITATRQAS* |
| Ga0116220_105861231 | 3300009525 | Peatlands Soil | LDGVSRELTDMMAAADAALYYAKETGRNKTHAISASAQAS* |
| Ga0116215_14279381 | 3300009672 | Peatlands Soil | ASRELTDMMAAADAALYYAKETGRNKTHVIRATAQASS* |
| Ga0116224_101535891 | 3300009683 | Peatlands Soil | ELTDMLAAADSARYYAKETGRNKTHVITATRQAS* |
| Ga0116216_105739291 | 3300009698 | Peatlands Soil | SRELTDMMAAADAALYYAKETGRNKTHVITSAAQAS* |
| Ga0116217_105383343 | 3300009700 | Peatlands Soil | AALDGTSRGLTDLLAAADAALYHAKETGRNKTHVLPASAHAF* |
| Ga0116219_102681803 | 3300009824 | Peatlands Soil | LDGERRELTDMLAAADSALYYAKETGRNKTHVITATRQAS* |
| Ga0074044_106105142 | 3300010343 | Bog Forest Soil | ELTDMLAAADAALYYAKETGRNKTHVITATAQAS* |
| Ga0126376_125861491 | 3300010359 | Tropical Forest Soil | ESRELTDMLAAADAALYHAKETGRNKTHVISATSQTA* |
| Ga0134128_106135853 | 3300010373 | Terrestrial Soil | ELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP* |
| Ga0134126_128892461 | 3300010396 | Terrestrial Soil | GVAALNGESRELTDMLAAADAALYHAKETGRNKTHVISASAPTV* |
| Ga0137366_107498341 | 3300012354 | Vadose Zone Soil | LDGENRELTDMLAAADAALYYAKETGRNKTHVISAAPSAT* |
| Ga0137385_107466061 | 3300012359 | Vadose Zone Soil | LDGESRELTDLLAAADAALYHAKETGRNKTHVISATSQTA* |
| Ga0157340_10270001 | 3300012473 | Arabidopsis Rhizosphere | ESQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP* |
| Ga0181525_104158161 | 3300014654 | Bog | NRELTDMLAAADAALYYAKETGRNKTHVSPASAPAS* |
| Ga0157377_111587911 | 3300014745 | Miscanthus Rhizosphere | LNGESRELTDMLAAADAALYHAKETGRNKTHVISASAPTA* |
| Ga0137412_104671961 | 3300015242 | Vadose Zone Soil | VAALNGEGRELTDMLAAADAALYHAKETGRNKTHVISASAPIA* |
| Ga0182032_101497441 | 3300016357 | Soil | SLDGETRELTDLLAAADAALYHAKETGRNKTHMISATSQTG |
| Ga0187818_101639481 | 3300017823 | Freshwater Sediment | SRELTDMMAAADAALYYAKETGRNKTHAISATAQASS |
| Ga0187807_12572432 | 3300017926 | Freshwater Sediment | GVASLDGASRELTDMLAAADAALYYAKETGRNRTHVIPASSQAS |
| Ga0187817_110997181 | 3300017955 | Freshwater Sediment | LDGTSRELTDMLAAADAALYYAKETGRNKTHVIPASAQAS |
| Ga0187783_100580751 | 3300017970 | Tropical Peatland | GERRELTDMMAAADAALYYAKETGRNKTHLITATRQAS |
| Ga0187781_104204961 | 3300017972 | Tropical Peatland | LDGDSRELTEMLAAADAALYHAKETGRNKTHVVTASAQAS |
| Ga0187781_110471073 | 3300017972 | Tropical Peatland | SLDGASRELTDMLAAADAALYYAKETGRNKTHVLPASAQAS |
| Ga0187810_102326282 | 3300018012 | Freshwater Sediment | VAALDETSRGLTDLLAAADAALYHAKETGRNKTHVLPASAHAS |
| Ga0187765_113771631 | 3300018060 | Tropical Peatland | GASRELTDMLAAADAALYHAKETGRNKTHVVTASARAS |
| Ga0187784_101528651 | 3300018062 | Tropical Peatland | DGTSPELTDMLAAADAALYYAKETGRNKTHVLPASAQAS |
| Ga0066669_100439011 | 3300018482 | Grasslands Soil | GESRELTDLLAAADAALYHAKETGRNKTHVISATSQTA |
| Ga0210407_106116041 | 3300020579 | Soil | SRELTDMLTAADSALYHAKETGRNKTHVVTANAPAS |
| Ga0210405_110166112 | 3300021171 | Soil | GASRELTDMLAAADAALYYAKETGRNKTHVISATAPAS |
| Ga0210397_108442021 | 3300021403 | Soil | LDGASRELTDMLAAADAAMYYAKETGRNKTHVITGTAQAT |
| Ga0210387_115365571 | 3300021405 | Soil | ALDRSRRELTDMLNAADAALYHAKETGRNKTHMVTANAPAS |
| Ga0210386_103900791 | 3300021406 | Soil | RELTDMLNAADAALYHAKETGRNKTHMVTANAPAS |
| Ga0210391_114935721 | 3300021433 | Soil | VASLDGESRELTDMLAAADSALYYAKETGRNKTHVIHASAQAS |
| Ga0210402_101121471 | 3300021478 | Soil | ETRELTDLLAAADAALYHAKETGRNKTHVITATSQTA |
| Ga0224565_10482421 | 3300024176 | Plant Litter | ALDSGSRELTDLMAAADAALYYAKETGRNRTHVISANV |
| Ga0247677_10436991 | 3300024245 | Soil | SQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP |
| Ga0207697_105643282 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | SVDEVLRAAADAALYHAKETGRNKTHMVSAGPQAP |
| Ga0208714_10890702 | 3300025527 | Arctic Peat Soil | RELTDMLAAADAALYYAKETGRNKTHVVTATTPAS |
| Ga0208480_10020656 | 3300025633 | Arctic Peat Soil | DGVSRELTDMVAAADAALYYAKEAGRNRTHVSTASAQH |
| Ga0207705_106495673 | 3300025909 | Corn Rhizosphere | ESQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP |
| Ga0207684_117210721 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVAALHGESRELTDMLAAADSALYYAKETGRNKTHSISAAVRAS |
| Ga0207652_110943483 | 3300025921 | Corn Rhizosphere | QELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP |
| Ga0207646_103829433 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LTSESQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP |
| Ga0207646_107591793 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SLDGESRELTDLLAAADSALYHAKETGRNKTHVISATSQTA |
| Ga0207664_113560131 | 3300025929 | Agricultural Soil | SRELTDLLAAADAALYHAKETGRNKTHVISATSETA |
| Ga0207664_117419312 | 3300025929 | Agricultural Soil | VAALDSENRELTDLLTAADAALYHAKETGRNKTHMVTASAPAP |
| Ga0207711_104288701 | 3300025941 | Switchgrass Rhizosphere | SESQELTDMLAAADAALYHAKETGRNKTHMVSAGPQAP |
| Ga0208367_1159812 | 3300027107 | Forest Soil | DGVSRQLTDMLTAADAALYHAKETGRNKTHVIHASAQAS |
| Ga0208725_10128711 | 3300027158 | Forest Soil | ALDGASRKLSDLMATADTALYHAKHTGRNRTHVISASIPNTP |
| Ga0209333_10548851 | 3300027676 | Forest Soil | SSLDGTNRELTDMLAAADAALYYAKETGRNKTHASPASAPAS |
| Ga0209274_104104791 | 3300027853 | Soil | VAALDGDHRQLTELLAAADAALYHAKVTGRNKTHMISSTAQVSSP |
| Ga0209274_104588823 | 3300027853 | Soil | SRELTDMLAAADAALYYAKETGRNRTHVIPASASAP |
| Ga0209693_100950973 | 3300027855 | Soil | SVGVAALSGANCELTDMLAAADTALYHAKVTGRNKTHVISAAAQASSP |
| Ga0209275_107142442 | 3300027884 | Soil | DGVSQELTDMMAAADAALYHAKETGRNKTHAITASAT |
| Ga0302220_101561893 | 3300028742 | Palsa | GSNRELTDMLAAADAALYHAKVTGRNKTHVMSATAQVSSP |
| Ga0308309_102381783 | 3300028906 | Soil | GESRKLTDMLAAADAALYHAKETGRNKTHVVTASARAS |
| Ga0311355_104773721 | 3300030580 | Palsa | ALDGEHRQLTDLLAAADAALYHAKVTGRNKTHLISSTAQVPSS |
| Ga0318528_107399182 | 3300031561 | Soil | QGGARELADLLAAADAALYHAKETGRNRTHVIPAAAQAS |
| Ga0318515_100332953 | 3300031572 | Soil | DGASRELTQMLAAADAALYHAKETGRNKTHVVTASAEAS |
| Ga0318574_101029563 | 3300031680 | Soil | DGSNRELADLLAAADAALYHAKETGRNRTHVIPAAAQAS |
| Ga0318574_105420803 | 3300031680 | Soil | LDGASRELTQMLAAADAALYHAKETGRNKTHVVTASAEAS |
| Ga0310686_1076444781 | 3300031708 | Soil | RELTDMLAAADAAMYYAKETGRNRTHVITGTAQAT |
| Ga0318493_102970421 | 3300031723 | Soil | GVASLDGANRELTDMLAAADAALYYAKETGRNKTHVIPASAPAS |
| Ga0318502_101558313 | 3300031747 | Soil | GVASLDGTSRELTDMLAAADAALYYAKETGRNKTHVIPASAQAS |
| Ga0307477_107871212 | 3300031753 | Hardwood Forest Soil | DGSRRELTDMLNAADAALYHAKETGRNKTHMVTANAPAS |
| Ga0318543_104453541 | 3300031777 | Soil | ASRELTQMLAAADAALYHAKETGRNKTHVVTASAEAS |
| Ga0318498_102806871 | 3300031778 | Soil | NRELTDMLAAADAALYYAKETGRNKTHVIPASAQAS |
| Ga0318576_105607901 | 3300031796 | Soil | RERPALDGSNRELADLLAAADAAVYHAKETGRNRTHVIPAAAQAS |
| Ga0307478_106247221 | 3300031823 | Hardwood Forest Soil | GVSRELTDMLTAADSALYHAKETGRNKTHVVTANAPAS |
| Ga0306923_108908973 | 3300031910 | Soil | SNRELADLLAAADAALYHAKETGRNRTHVIPAAAQAS |
| Ga0310910_110442141 | 3300031946 | Soil | VASLDDENRELTDLLAAADAALYHAKETGRNKTHMISATSQTG |
| Ga0310910_115511332 | 3300031946 | Soil | ALDGASRELTEMLAAADAALYHAKETGRNKTHVVTASAEAS |
| Ga0318531_105889161 | 3300031981 | Soil | DGSNRELADLLAAADAAVYHAKETGRNRTHVIPAAAQAS |
| Ga0318556_103133721 | 3300032043 | Soil | LDGTSRELTDMLAAADAALYYAKETGRNKTHVIPASAPAS |
| Ga0318518_102172451 | 3300032090 | Soil | ITRRARELAYLLAAADAALYHAKETGRNRTHVIPAAAQAS |
| Ga0311301_104675161 | 3300032160 | Peatlands Soil | GERRELTDMLAAADSALYYAKETGRNKTHVITATRQAS |
| Ga0311301_112761112 | 3300032160 | Peatlands Soil | VVSRELTDMMAAADAALYYAKETGRNKTHAISASAQAS |
| Ga0311301_115995363 | 3300032160 | Peatlands Soil | VAALDGERRELTDMLAAADSALYYAKETGRNKTHVITATRQAS |
| Ga0306920_1009174131 | 3300032261 | Soil | GASRELTEMLAAADAALYHAKETGRNKTHVVTASAEAS |
| Ga0306920_1026294821 | 3300032261 | Soil | SLDGESRELTDLLAAADAALYHAKETGRNKTHLISATSQTA |
| Ga0335085_103003983 | 3300032770 | Soil | ASRELTDLMAAADAALYYAKETGRNKTHVITSAAPAS |
| Ga0335085_104345641 | 3300032770 | Soil | GESRELTDLLAAADAALYHAKETGRNKTHVISASSQTA |
| Ga0335085_105485453 | 3300032770 | Soil | ASLDGENRELTDLLAAADAALYHAKETGRNKTHVISATSPTA |
| Ga0335079_113556643 | 3300032783 | Soil | AGRELTDMLAAADAALYHAKETGRNKTHVVTASAQAS |
| Ga0335070_112871401 | 3300032829 | Soil | SLDGESRELTDLLAAADAALYHAKETGRNKTHVISATSSTT |
| Ga0335074_1002030310 | 3300032895 | Soil | VGIAALDGTARELTDLLAAADSALYYAKDNGRNKTHAMAAVGLR |
| ⦗Top⦘ |