| Basic Information | |
|---|---|
| Family ID | F105711 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 37 residues |
| Representative Sequence | RADELIERSKDVAVRKKDSISAAVEAGREAYLRESKS |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF06103 | DUF948 | 45.00 |
| PF03054 | tRNA_Me_trans | 18.00 |
| PF00266 | Aminotran_5 | 4.00 |
| PF00023 | Ank | 1.00 |
| PF01566 | Nramp | 1.00 |
| PF12732 | YtxH | 1.00 |
| PF09837 | DUF2064 | 1.00 |
| PF12704 | MacB_PCD | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG4768 | Uncharacterized conserved protein YoxC, contains an MCP-like domain | Function unknown [S] | 45.00 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 18.00 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_105286307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300001167|JGI12673J13574_1011917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100156888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2151 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100588563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 989 | Open in IMG/M |
| 3300005541|Ga0070733_10140797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1561 | Open in IMG/M |
| 3300005542|Ga0070732_10871932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300005591|Ga0070761_11046597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300005602|Ga0070762_10018806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3580 | Open in IMG/M |
| 3300005921|Ga0070766_11071903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300006052|Ga0075029_100369460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300006052|Ga0075029_100478917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300006173|Ga0070716_101156025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300006176|Ga0070765_100398933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1284 | Open in IMG/M |
| 3300006797|Ga0066659_10322959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
| 3300006800|Ga0066660_10256347 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300007265|Ga0099794_10420114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300007788|Ga0099795_10463420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300009038|Ga0099829_11092066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300009088|Ga0099830_10065253 | All Organisms → cellular organisms → Bacteria | 2620 | Open in IMG/M |
| 3300009137|Ga0066709_103146697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300009137|Ga0066709_103232802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300009631|Ga0116115_1056523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1036 | Open in IMG/M |
| 3300009665|Ga0116135_1378939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300010046|Ga0126384_10634888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300010046|Ga0126384_10973698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300010301|Ga0134070_10188983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300010379|Ga0136449_102606683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300011269|Ga0137392_10222064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1550 | Open in IMG/M |
| 3300012203|Ga0137399_10048091 | All Organisms → cellular organisms → Bacteria | 3079 | Open in IMG/M |
| 3300012208|Ga0137376_11405475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300012351|Ga0137386_10197214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1446 | Open in IMG/M |
| 3300012362|Ga0137361_11934247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300012922|Ga0137394_10225176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1603 | Open in IMG/M |
| 3300012922|Ga0137394_10520304 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1010 | Open in IMG/M |
| 3300012923|Ga0137359_10986198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300012923|Ga0137359_11227392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300012923|Ga0137359_11559670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300012925|Ga0137419_11050506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300012929|Ga0137404_10705092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300012931|Ga0153915_12018297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300012971|Ga0126369_12326119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300012977|Ga0134087_10562964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
| 3300015241|Ga0137418_10242058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1536 | Open in IMG/M |
| 3300016270|Ga0182036_10315420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1194 | Open in IMG/M |
| 3300016294|Ga0182041_11962358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300017654|Ga0134069_1129440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300017942|Ga0187808_10611943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300017961|Ga0187778_10630410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300017999|Ga0187767_10214068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300018060|Ga0187765_10125820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1424 | Open in IMG/M |
| 3300018088|Ga0187771_11591527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300018090|Ga0187770_10021296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4400 | Open in IMG/M |
| 3300018468|Ga0066662_11959398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300020170|Ga0179594_10063008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1277 | Open in IMG/M |
| 3300020579|Ga0210407_11292959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300020580|Ga0210403_10407738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300021168|Ga0210406_10026239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5330 | Open in IMG/M |
| 3300021178|Ga0210408_10950312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300021402|Ga0210385_10274980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1243 | Open in IMG/M |
| 3300021402|Ga0210385_10561563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
| 3300021407|Ga0210383_10323426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1328 | Open in IMG/M |
| 3300021407|Ga0210383_10865748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300021420|Ga0210394_11693417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300021478|Ga0210402_11206458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300021559|Ga0210409_11284047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300021559|Ga0210409_11301065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300021559|Ga0210409_11529656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300022509|Ga0242649_1070047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300022525|Ga0242656_1039787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300022532|Ga0242655_10204959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300022533|Ga0242662_10099645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300026297|Ga0209237_1144904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300026304|Ga0209240_1044458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1681 | Open in IMG/M |
| 3300026312|Ga0209153_1177456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300026334|Ga0209377_1314051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300026342|Ga0209057_1035815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2534 | Open in IMG/M |
| 3300027537|Ga0209419_1087566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300027605|Ga0209329_1095598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300027655|Ga0209388_1065564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
| 3300027768|Ga0209772_10067457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300027842|Ga0209580_10602061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300027862|Ga0209701_10720945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300027898|Ga0209067_10746089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300030738|Ga0265462_11109812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300031231|Ga0170824_117528019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1283 | Open in IMG/M |
| 3300031236|Ga0302324_100582888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1609 | Open in IMG/M |
| 3300031474|Ga0170818_105593544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
| 3300031544|Ga0318534_10633626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300031668|Ga0318542_10320831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300031719|Ga0306917_10010229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5365 | Open in IMG/M |
| 3300031720|Ga0307469_10908641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300031753|Ga0307477_10615341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300031799|Ga0318565_10095271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300031821|Ga0318567_10320239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300031959|Ga0318530_10324407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300032205|Ga0307472_101622139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300032261|Ga0306920_102473993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300033158|Ga0335077_10227709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2078 | Open in IMG/M |
| 3300033158|Ga0335077_10813833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300033402|Ga0326728_10023208 | All Organisms → cellular organisms → Bacteria | 11400 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.00% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001167 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1052863072 | 3300000955 | Soil | RADELIERGKDVATRKRDSLTAAVEAGREAFLRESKS* |
| JGI12673J13574_10119171 | 3300001167 | Forest Soil | ELIERSKDVASRKKDSISAAVDAGREAYLREASKS* |
| JGIcombinedJ26739_1001568884 | 3300002245 | Forest Soil | ADELIERSKEVAGRKRDSISAAVEAGREAFLRESKS* |
| JGIcombinedJ26739_1005885633 | 3300002245 | Forest Soil | RADELVERSKDVASRKKDSIAAAVEAGREAYLRESKA* |
| Ga0070733_101407971 | 3300005541 | Surface Soil | LIERGKEVAGRQKESISAAVEGAREAYRREAAKS* |
| Ga0070732_108719322 | 3300005542 | Surface Soil | DDLIERGKEVAGRQKESISAAVEGAREAYRREAAKS* |
| Ga0070761_110465971 | 3300005591 | Soil | LRERADELVERGKDVAKGKRDSLSAAVEAGREAYLRESKS* |
| Ga0070762_100188061 | 3300005602 | Soil | LIERSKDAATRGKDSISAAVEGAREAYRREASKS* |
| Ga0070766_110719031 | 3300005921 | Soil | ELVERSKDVASRKKDSIAAAVEAGREAYLRESKA* |
| Ga0075029_1003694603 | 3300006052 | Watersheds | LRERADELIERGKDVASRKRESLSAAVEAGREAFLRESKS* |
| Ga0075029_1004789172 | 3300006052 | Watersheds | RERAEELIERGKDVAVRQKDSISAAVEGAREAYRREAKS* |
| Ga0070716_1011560251 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ERADDLVERGKDAASRHKETISAAVDGAREAYRREASKS* |
| Ga0070765_1003989333 | 3300006176 | Soil | ELRDRADELIERGKDVASRKRDSLSAAVEAGREAFLRESKS* |
| Ga0066659_103229593 | 3300006797 | Soil | LVERGKDAASRHKETITAAVDGAREAYRREASKS* |
| Ga0066660_102563474 | 3300006800 | Soil | ELIERGKEVAVRKKDSISAAVEAGREAYLRESKQS* |
| Ga0099794_104201142 | 3300007265 | Vadose Zone Soil | ERADELIERSKEVAVRKKDSISAAVEAGREAYLRESKS* |
| Ga0099795_104634202 | 3300007788 | Vadose Zone Soil | DELIERSKDVAVRKKDSISSAVEAGREAYLRESAKS* |
| Ga0099829_110920662 | 3300009038 | Vadose Zone Soil | ELIERGKDVAGRKKDSISAAVEAGREAYLRESAKS* |
| Ga0099830_100652534 | 3300009088 | Vadose Zone Soil | LRERADELIERSKEIAVSKKDSISAAVEAGREAYLRQSKS* |
| Ga0066709_1031466972 | 3300009137 | Grasslands Soil | LIERSKEIAVSKKDSISAAVEAGREAYLRQSKSS* |
| Ga0066709_1032328021 | 3300009137 | Grasslands Soil | RADELIERSKDVAVRKKDSLSAAVEAGREAYLRESKA* |
| Ga0116115_10565233 | 3300009631 | Peatland | DLIERGKDVAARKRDSIAAAVDAGREAFLRETKS* |
| Ga0116135_13789391 | 3300009665 | Peatland | LRERADELVERSKDVANRKKDSIAAAVEAGREAYLRESKA* |
| Ga0126384_106348881 | 3300010046 | Tropical Forest Soil | RADDLIERGKDAASRHKETISAAVEGARDAYRREAAKS* |
| Ga0126384_109736981 | 3300010046 | Tropical Forest Soil | RADELIERGKDVAVRKRDSISAAVDAGREAFLRESKS* |
| Ga0134070_101889833 | 3300010301 | Grasslands Soil | LIERGKEAAAREKDSLGAAVEAGREAYERHKAKAQ* |
| Ga0136449_1026066831 | 3300010379 | Peatlands Soil | DELIERGKDVATRKRDSLTAAVEAGREAFLRESKS* |
| Ga0137392_102220642 | 3300011269 | Vadose Zone Soil | MRGRADELIERSKEIAGNKKDSITAAVEAGREAYLRQSKS* |
| Ga0137399_100480914 | 3300012203 | Vadose Zone Soil | ADELIERSKEVAVRKKDSISAAVEAGREAYLRESKS* |
| Ga0137376_114054751 | 3300012208 | Vadose Zone Soil | ADELIERGKEVAIRQKDSISAAVEGAQEAYRKAAKS* |
| Ga0137386_101972141 | 3300012351 | Vadose Zone Soil | DELIERGKDVASKQKESISAAVEGAREAYRREAGKA* |
| Ga0137361_119342472 | 3300012362 | Vadose Zone Soil | ADDLVERGKDAASRHKETITAAVEGARDAYRREASKS* |
| Ga0137394_102251761 | 3300012922 | Vadose Zone Soil | RADELIERSKEVAVRKKDSISAAVEAGREAYLRESKS* |
| Ga0137394_105203041 | 3300012922 | Vadose Zone Soil | ADELIERSKDVAVRKKDSISAAVEAGREAYLRESKS* |
| Ga0137359_109861982 | 3300012923 | Vadose Zone Soil | LRERADELIERGKDVASKKRESLSAAVDAGREAFLRESKS* |
| Ga0137359_112273922 | 3300012923 | Vadose Zone Soil | ADELIERSKDVAVRKKDSISSAVEAGREAYLRESAKS* |
| Ga0137359_115596701 | 3300012923 | Vadose Zone Soil | RADELIERSKEIAVSKKDSITAAVEAGREAYLRQSKS* |
| Ga0137419_110505062 | 3300012925 | Vadose Zone Soil | ERADELIERSKEVAGRKKDSISAAVEAGREAYLRESKS* |
| Ga0137404_107050921 | 3300012929 | Vadose Zone Soil | LRERADELIERGKDVASRQKESISAAVEGAREAYRREAGKA* |
| Ga0153915_120182971 | 3300012931 | Freshwater Wetlands | RADDLLERGKEVASRQKESLSAAVEAGREAYQREKSKS* |
| Ga0126369_123261191 | 3300012971 | Tropical Forest Soil | DRADELIERGKDVASRQKESISAAVEGAREAYRREAAKG* |
| Ga0134087_105629641 | 3300012977 | Grasslands Soil | DELIERSKEVAVRKKDSISAAVEAGREAYLREAKS* |
| Ga0137418_102420583 | 3300015241 | Vadose Zone Soil | LRERADELVERGKEVAVRKKDSISAAVEAGREAYLRESKS* |
| Ga0182036_103154203 | 3300016270 | Soil | DELIERGKDVATRKRDSLTAAVEAGREAFLRESKS |
| Ga0182041_119623582 | 3300016294 | Soil | ADDLIERGKEAANRHKDTISAALDGARDAYRREATKS |
| Ga0134069_11294403 | 3300017654 | Grasslands Soil | RERADELIERGKDVASKQKESISAAVEGAREAYRREAGKA |
| Ga0187808_106119431 | 3300017942 | Freshwater Sediment | DDLIERGKDIATRKRDSLSAAVEAGREAFLRESKS |
| Ga0187778_106304102 | 3300017961 | Tropical Peatland | LRDRADELIERGKDVAARKRDSIAAAVDAGREAFLRETKS |
| Ga0187767_102140682 | 3300017999 | Tropical Peatland | RADELIERGKDVASRKRESLSAAVEAGREAFLRESKS |
| Ga0187765_101258203 | 3300018060 | Tropical Peatland | DRADELIERGKDVASRKRESLSAAVEAGREAFLRESKS |
| Ga0187771_115915272 | 3300018088 | Tropical Peatland | DRADELIERGKDAATRKRDSLSAAVEAGREAFLRESKS |
| Ga0187770_100212961 | 3300018090 | Tropical Peatland | DELIERGKDAATRKRDSLSAAVEAGREAFLRESKS |
| Ga0066662_119593982 | 3300018468 | Grasslands Soil | ELIERSKEIAVSKKDSISAAVEAGREAYLRQSKSS |
| Ga0179594_100630081 | 3300020170 | Vadose Zone Soil | RADELIERSKDVAVRKKDSISAAVEAGREAYLRESKS |
| Ga0210407_112929592 | 3300020579 | Soil | ELIERSKDVASRKKDSISAAVDAGREAYLREASKS |
| Ga0210403_104077381 | 3300020580 | Soil | RERADELIERGKDVASKKRESLSAAVDAGREAFLRESKS |
| Ga0210406_100262397 | 3300021168 | Soil | DDLIERSKDAATRGKDSISAAVEGAREAYRREASKS |
| Ga0210408_109503121 | 3300021178 | Soil | RADELIERGKDVASRKRESLSAAVDAGREAFLRESKS |
| Ga0210385_102749803 | 3300021402 | Soil | LRERADELVERGKDVAKGKRDSISAAVEAGREAYLRESKS |
| Ga0210385_105615631 | 3300021402 | Soil | YLIERSKDAATRGKDSISAAVEGAREAYRREASKS |
| Ga0210383_103234263 | 3300021407 | Soil | RADDLIERSKDAATRGKDSISAAVEGAREAYRREASKS |
| Ga0210383_108657481 | 3300021407 | Soil | ADELIERGKDVASRKKESISAAVDAGREAYLREATARPERS |
| Ga0210394_116934171 | 3300021420 | Soil | ERADELVERGKEVAVRKKDSISAAVEAGREAYLRESKS |
| Ga0210402_112064581 | 3300021478 | Soil | ADELIERSKEVATRQKDSISAAVEGAREAYRREAKA |
| Ga0210409_112840472 | 3300021559 | Soil | ERADDLIERSKDAATRGKDSISAAVEGAREAYRREASKS |
| Ga0210409_113010651 | 3300021559 | Soil | ERADELIERGKDVASKKRESLSAAVDAGREAFLRESKS |
| Ga0210409_115296562 | 3300021559 | Soil | ERGERADELIERSKEVAVRKKDSISAAVEAGREAYLRESKS |
| Ga0242649_10700471 | 3300022509 | Soil | DELIERGKDVASRKKESISAAVDAGREAYLREASARPERS |
| Ga0242656_10397872 | 3300022525 | Soil | DELIERSKDVAVRKKDSIAAAVDAGREAYLRESKS |
| Ga0242655_102049592 | 3300022532 | Soil | RERADELIERSKEVAVRKKDSISAAVEAGREAYLRESKS |
| Ga0242662_100996451 | 3300022533 | Soil | DELIERGKDVASRKRESLSAAVDAGREAFLRESKS |
| Ga0209237_11449042 | 3300026297 | Grasslands Soil | ADELIERSKEIAVNKKDSITAAVEAGREAYLRQSKS |
| Ga0209240_10444583 | 3300026304 | Grasslands Soil | RADELIERSKDVAVRKKDSIAAAVDAGREAYLRESKS |
| Ga0209153_11774562 | 3300026312 | Soil | LRERADELIERGKEVATRQKDSVSAAVEAGREAYLRHSKQTS |
| Ga0209377_13140512 | 3300026334 | Soil | RERADELIERSKEIAVSKKDSISAAVEAGREAYLRQSKSS |
| Ga0209057_10358154 | 3300026342 | Soil | RERADELIERGKDVAVRKKDSISAAVEAGREAYLRESKQS |
| Ga0209419_10875661 | 3300027537 | Forest Soil | ELIERGKDVAGRKKDSISAAVEAGREAYLRESAKS |
| Ga0209329_10955982 | 3300027605 | Forest Soil | DELIERGKDVASKKRESLSAAVDAGREAFLRESKS |
| Ga0209388_10655641 | 3300027655 | Vadose Zone Soil | ADELIERSKDVAVRKKDSIAAAVDAGREAYLRESKS |
| Ga0209772_100674571 | 3300027768 | Bog Forest Soil | DLIERGKDVAARKKESISAAVDAGREAYLREASGRADRS |
| Ga0209580_106020612 | 3300027842 | Surface Soil | DLIERGKEVAGRQKESISAAVEGAREAYRREAAKS |
| Ga0209701_107209451 | 3300027862 | Vadose Zone Soil | ERADELIERSKEIAVNKKDSITAAVEAGREAYLRQSKS |
| Ga0209067_107460892 | 3300027898 | Watersheds | RADDLLEKGKEVASRKRESLTAAVEAGRDAFLRESKS |
| Ga0265462_111098122 | 3300030738 | Soil | RERADELVERSKDVANRKKDSIAAAVEAGREAYLRESKA |
| Ga0170824_1175280193 | 3300031231 | Forest Soil | ERADDLVERGKDAASRHKETITAAVEGARDAYRREASKS |
| Ga0302324_1005828881 | 3300031236 | Palsa | LIERGKDVAARKKESISAAVDAGREAYLREASGRAERS |
| Ga0170818_1055935442 | 3300031474 | Forest Soil | DDLVERGKDAASRHKETISAAVEGARDAYRREASKS |
| Ga0318534_106336261 | 3300031544 | Soil | KELRDRADDLVERGKDLASKKRESIAAAVDSAREAYLRESKS |
| Ga0318542_103208312 | 3300031668 | Soil | ELRDRADDLVERGKDLASKKRESIAAAVDSAREAYLRESKS |
| Ga0306917_100102291 | 3300031719 | Soil | ELIERGKEVAVRKKDSISAAVEAGREAYLRESKQS |
| Ga0307469_109086412 | 3300031720 | Hardwood Forest Soil | DDLVERGKDAASRHKETITAAVEGARDAYRREASKS |
| Ga0307477_106153412 | 3300031753 | Hardwood Forest Soil | DELIERGKEVAVRHKDSISAAVEGAREAYRREAKS |
| Ga0318565_100952713 | 3300031799 | Soil | LRDRADDLVERGKDLASKKRESIAAAVDSAREAYLRESKS |
| Ga0318567_103202392 | 3300031821 | Soil | DDLIERGKDVAARKRESLTAAVEAGREAFLRESKS |
| Ga0318530_103244072 | 3300031959 | Soil | RADDLVERGKDLASKKRESIAAAVDSAREAYLRESKS |
| Ga0307472_1016221391 | 3300032205 | Hardwood Forest Soil | ERADELIERSKDVAVRKKDSISAAVEAGREAYLRESKS |
| Ga0306920_1024739932 | 3300032261 | Soil | KARELRDRADELIERGKDAASRKRDSLSAAVEAGREAFLRETKS |
| Ga0335077_102277091 | 3300033158 | Soil | ERADELIERGKDVATRKRDSLTAAVEAGREAFLRESKS |
| Ga0335077_108138333 | 3300033158 | Soil | ADDLIERGKDLATRKRDSLSAAVEAGREAFLRESKS |
| Ga0326728_100232081 | 3300033402 | Peat Soil | DDLIERGKDVAARKRDSIAAAVDAGREAFLRETKS |
| ⦗Top⦘ |