| Basic Information | |
|---|---|
| Family ID | F105709 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MQFGLSESQEFLKDSARKFFAGECPAAEVRRLMETE |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.00 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00441 | Acyl-CoA_dh_1 | 45.00 |
| PF02771 | Acyl-CoA_dh_N | 29.00 |
| PF02770 | Acyl-CoA_dh_M | 10.00 |
| PF13193 | AMP-binding_C | 4.00 |
| PF09413 | DUF2007 | 3.00 |
| PF00719 | Pyrophosphatase | 1.00 |
| PF02190 | LON_substr_bdg | 1.00 |
| PF13561 | adh_short_C2 | 1.00 |
| PF01566 | Nramp | 1.00 |
| PF11306 | DUF3108 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 84.00 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 1.00 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002JPWHU | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300001084|JGI12648J13191_1024927 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300001175|JGI12649J13570_1003678 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
| 3300001471|JGI12712J15308_10129221 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300005332|Ga0066388_103332410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 821 | Open in IMG/M |
| 3300005526|Ga0073909_10664482 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005531|Ga0070738_10139397 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300005764|Ga0066903_105698935 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005921|Ga0070766_10556919 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300005921|Ga0070766_10898665 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006059|Ga0075017_101467273 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300006173|Ga0070716_101190362 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300006176|Ga0070765_100157145 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
| 3300009661|Ga0105858_1030875 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300010048|Ga0126373_10932957 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300010373|Ga0134128_12206152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300010396|Ga0134126_12423153 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300010397|Ga0134124_11808918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300011269|Ga0137392_10306826 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300011271|Ga0137393_11586393 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012202|Ga0137363_10741907 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300012922|Ga0137394_10039696 | All Organisms → cellular organisms → Bacteria | 3856 | Open in IMG/M |
| 3300012924|Ga0137413_10603643 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300012924|Ga0137413_11509661 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300012989|Ga0164305_10265000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1250 | Open in IMG/M |
| 3300013296|Ga0157374_12786295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300014156|Ga0181518_10465558 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300015242|Ga0137412_10581089 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300016404|Ga0182037_10998574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300017925|Ga0187856_1254107 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300017961|Ga0187778_10229354 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300017975|Ga0187782_11151774 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300017994|Ga0187822_10151050 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300017995|Ga0187816_10117164 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300018016|Ga0187880_1145858 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300018085|Ga0187772_11202502 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300020579|Ga0210407_10734713 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300020582|Ga0210395_10369522 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300021170|Ga0210400_10114648 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
| 3300021170|Ga0210400_10842913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300021171|Ga0210405_10488043 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300021171|Ga0210405_10990169 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300021181|Ga0210388_10202959 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300021405|Ga0210387_10325336 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300021406|Ga0210386_10016272 | All Organisms → cellular organisms → Bacteria | 5803 | Open in IMG/M |
| 3300021420|Ga0210394_10934866 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300021420|Ga0210394_11663829 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300021433|Ga0210391_10303618 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300021433|Ga0210391_10513615 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300021474|Ga0210390_10121962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2184 | Open in IMG/M |
| 3300021475|Ga0210392_10931836 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300021478|Ga0210402_10145461 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
| 3300021478|Ga0210402_11319149 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300021479|Ga0210410_10570526 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300021559|Ga0210409_10143607 | All Organisms → cellular organisms → Bacteria | 2188 | Open in IMG/M |
| 3300021559|Ga0210409_10172092 | All Organisms → cellular organisms → Bacteria | 1979 | Open in IMG/M |
| 3300022722|Ga0242657_1000599 | All Organisms → cellular organisms → Bacteria | 3835 | Open in IMG/M |
| 3300025915|Ga0207693_11171657 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300025924|Ga0207694_11693077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300025934|Ga0207686_11238304 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300025941|Ga0207711_10679310 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300026334|Ga0209377_1106683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1152 | Open in IMG/M |
| 3300026359|Ga0257163_1018710 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300026515|Ga0257158_1115937 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300026552|Ga0209577_10804478 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300026819|Ga0207765_106743 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300027527|Ga0209684_1049191 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300027562|Ga0209735_1024249 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300027660|Ga0209736_1036471 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300027703|Ga0207862_1068391 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300027875|Ga0209283_10146554 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300027875|Ga0209283_10646223 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300027889|Ga0209380_10682218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300027911|Ga0209698_11403162 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300028906|Ga0308309_11398247 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300030053|Ga0302177_10026244 | All Organisms → cellular organisms → Bacteria | 3684 | Open in IMG/M |
| 3300031128|Ga0170823_14967943 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031231|Ga0170824_117550822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300031234|Ga0302325_11075752 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300031538|Ga0310888_10390541 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300031708|Ga0310686_101287935 | All Organisms → cellular organisms → Bacteria | 2971 | Open in IMG/M |
| 3300031708|Ga0310686_101577561 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300031715|Ga0307476_10195425 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300031715|Ga0307476_10241100 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300031718|Ga0307474_11502647 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031751|Ga0318494_10346578 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300031833|Ga0310917_10100427 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300031939|Ga0308174_11313243 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300031944|Ga0310884_10316179 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300032059|Ga0318533_10346728 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300032076|Ga0306924_11339837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 767 | Open in IMG/M |
| 3300032091|Ga0318577_10015005 | All Organisms → cellular organisms → Bacteria | 3128 | Open in IMG/M |
| 3300032180|Ga0307471_102207038 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300032180|Ga0307471_102707201 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300032805|Ga0335078_12436722 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300032828|Ga0335080_11899746 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300032829|Ga0335070_10528073 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300032892|Ga0335081_12238509 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300033412|Ga0310810_10361499 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300033561|Ga0371490_1132114 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.00% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026819 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_02451160 | 2170459003 | Grass Soil | MQFGLSESQRILQSNARKFFAAECPISEVRRIMETDTAQDARL |
| JGI12648J13191_10249272 | 3300001084 | Forest Soil | MQFGXNESQXILKQNARQFFAGECPMQHVRHLAESKQPYDFA |
| JGI12649J13570_10036784 | 3300001175 | Forest Soil | MQFGLSESQEFLKDSARKFFAGECPSAEMRRLMET |
| JGI12712J15308_101292212 | 3300001471 | Forest Soil | MQFGLSESQEFLKNSARKFFAGECPSAEMRRLMATETAYDA |
| Ga0066388_1033324101 | 3300005332 | Tropical Forest Soil | MQFGLSESQQILKDTSRKFFSGECPVAEVRRLMETETAYNA |
| Ga0073909_106644821 | 3300005526 | Surface Soil | MQFGLSESQQILKDTARKFFAGESPIAAVRKAMET |
| Ga0070738_101393971 | 3300005531 | Surface Soil | MQFGLNESQKILQSNARKFFAAECSPADVRRIMETETAHDDKLWLH |
| Ga0066903_1056989351 | 3300005764 | Tropical Forest Soil | MQFGLSESQQILKDTARKFFAGEIPIAAVRKAMETGTAYDA |
| Ga0070766_105569192 | 3300005921 | Soil | MQFGLSESQKMLKDNARKFFAGECPMEEVRRLMETDT |
| Ga0070766_108986652 | 3300005921 | Soil | MQFGLSESQEFLKDSARKFFAGECPSAEVRRLMDTD |
| Ga0075017_1014672732 | 3300006059 | Watersheds | MEFGLSESQEFLKDSARKFFAGECPSAEMRRLMETDT |
| Ga0070716_1011903622 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MQFGLSESQQILKDTARKFFAGESPIAAVRKAMETGTAYD |
| Ga0070765_1001571451 | 3300006176 | Soil | MQFGLNESQKILKENARQFFAGECPMTLVRQLAESKQPHDPS |
| Ga0105858_10308752 | 3300009661 | Permafrost Soil | MQFGLSESQQILKDTAKKFFAGESAMADARKLMETETAYDAVLWRKL |
| Ga0126373_109329571 | 3300010048 | Tropical Forest Soil | MQFGLNESQEILKDGARKFFAGECPISEVRRLADTDTAFDASLWAK |
| Ga0134128_122061522 | 3300010373 | Terrestrial Soil | MQFGLSESQTILRDSAREFFAGECPMARVRRLADTDTAH |
| Ga0134126_124231532 | 3300010396 | Terrestrial Soil | MQFGLSESQQILKDTARKFFAGESPIATVRNAMETEAAYNVAL |
| Ga0134124_118089182 | 3300010397 | Terrestrial Soil | MQFGLSESQQILKDTAHKFFAGESPIAAVRKAMETETSYDAVLWTKLAEQ |
| Ga0137392_103068262 | 3300011269 | Vadose Zone Soil | MQFGLSESQQILKDTARKFFAGESPIAAVRKSMETETAHDA |
| Ga0137393_115863932 | 3300011271 | Vadose Zone Soil | MQFGLNESQEFLRDSAHKFFAGECPITEVRRLMETDTAFGA |
| Ga0137363_107419071 | 3300012202 | Vadose Zone Soil | MQFGLSESQQILKDTARKFFAGESPIAAVRKAMQTDTAYDAAL |
| Ga0137394_100396964 | 3300012922 | Vadose Zone Soil | MQFGLTESQEFLKNSARKFFAGECPSMEMRRVMQTDTAYD |
| Ga0137413_106036432 | 3300012924 | Vadose Zone Soil | MQFGLSESQQILKDTARKIFDGESPIAAVRKAMETDTAYDA |
| Ga0137413_115096612 | 3300012924 | Vadose Zone Soil | MLKRSTTMQFGLSESQQILKDTARKFFAGESPTAAVRKAIETD |
| Ga0164305_102650003 | 3300012989 | Soil | MQFGLSESQQILKDTAHKFFAGESPIAAVRKAMETETAYDA |
| Ga0157374_127862952 | 3300013296 | Miscanthus Rhizosphere | MQFGLSESQQILKDTARKFFAGESPIAAVRKAMGTESAYD |
| Ga0181518_104655581 | 3300014156 | Bog | MQFGLSESQEILKDNARKFFAGECPMNQVRKLAETGSAYD |
| Ga0137412_105810892 | 3300015242 | Vadose Zone Soil | MQFGLSESQQILKDTARKFFAGESPIAAVRRAMETE |
| Ga0182037_109985743 | 3300016404 | Soil | MQFGLSESQQILKDTARKFFSGECAIAEVRRLMESDTA |
| Ga0187856_12541071 | 3300017925 | Peatland | MEFGLNESQQLLKDNARKFFAGECPMAEVRRIMETDTAYDA |
| Ga0187778_102293541 | 3300017961 | Tropical Peatland | MEFGLSESQQLLKDNARKFFATECPMAQVRRLMET |
| Ga0187782_111517741 | 3300017975 | Tropical Peatland | MEFGLSESQQLLKDNARKFFAGECPIEEVRRLMDTE |
| Ga0187822_101510502 | 3300017994 | Freshwater Sediment | MEFGLSESQQFLKDNARKFFAGECPMAEVRRIMETDAADDAA |
| Ga0187816_101171641 | 3300017995 | Freshwater Sediment | MEFGLSESQQMLKENARKFFAGECPMSEVRRLMETDSAYD |
| Ga0187880_11458582 | 3300018016 | Peatland | MQFGLNESQEILKQNARQFFAGECPMTHVRHLAESKQPY |
| Ga0187772_112025021 | 3300018085 | Tropical Peatland | MEFGLNESQEILRDSARSFFTGECPMSEVRRLMETDAA |
| Ga0210407_107347132 | 3300020579 | Soil | MQFGLSESQEFLKDSARKFFAGECPSAQMRRLMETDT |
| Ga0210395_103695222 | 3300020582 | Soil | MEFGLNESQVLLKDNARKFFAGECPMEEVRRLMETETAHD |
| Ga0210400_101146483 | 3300021170 | Soil | MQFGLSESQQILKDTARKFFAGESPIAAVRKSMETDTAY |
| Ga0210400_108429132 | 3300021170 | Soil | MQFGLSESQTILKNNARKFFAAECPIAEVRRVMETPTAHDDKLWRH |
| Ga0210405_104880431 | 3300021171 | Soil | MQFGLSESQEFLKNSARKFFAGECPSSEMRRLMETDTAYD |
| Ga0210405_109901691 | 3300021171 | Soil | MEFGLSESQKFLKDSARKFFAGECPSVEMRRLMET |
| Ga0210388_102029593 | 3300021181 | Soil | MQFGLSESQEFLKDSTRKFFTGECPAADMRRLMETDTAY |
| Ga0210387_103253362 | 3300021405 | Soil | MEFGLSESQVILKDSARKFFAGECPMEEVRRLMETETAYDE |
| Ga0210386_100162725 | 3300021406 | Soil | MQFGLSESQELLKDGARKFFAGECPNTEMRRLMETET |
| Ga0210394_109348661 | 3300021420 | Soil | MQFGLTESQEFLKNSARQFFAGECPSAEMRRLMETDT |
| Ga0210394_116638291 | 3300021420 | Soil | MQFGLSEGQEFLKESAHKFFAGECSSAEMRRLMETETAY |
| Ga0210391_103036181 | 3300021433 | Soil | MQFGLSESQEMLRDGARKFFAGECPNSEMRRLMETE |
| Ga0210391_105136152 | 3300021433 | Soil | MQFGLSESQEFLKDSARKFFAGECPSAEVRRLMDTGSAY |
| Ga0210390_101219621 | 3300021474 | Soil | MQFGLNESQEILKQNARQFFAGECPMTLVRELAESKQPYDAAL |
| Ga0210392_109318361 | 3300021475 | Soil | MQFGLSESQQILKSNARKFFAAECPISEVRRIMETDTAQDKK |
| Ga0210402_101454611 | 3300021478 | Soil | MQFGLTERQEFLKDSARKFFAGECPSAEMRRLMETD |
| Ga0210402_113191491 | 3300021478 | Soil | MQFGLSESQQILKTNARKFFAAECPMTEVRRIMETE |
| Ga0210410_105705261 | 3300021479 | Soil | MQFGLNESQEFLKDSARKFFAGECPSAEMRRLMETNTAYD |
| Ga0210409_101436073 | 3300021559 | Soil | MQFGLSASQEILKDSARKFFAGECPIAEVRRLMETD |
| Ga0210409_101720923 | 3300021559 | Soil | MQFGLSESQQLLKANARKFFAGECPMEKVRQLLKTDTAFDRE |
| Ga0242657_10005994 | 3300022722 | Soil | MQFGLSESQEFLRDSARKFFAGECSSAEMRRLMET |
| Ga0207693_111716572 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MQFGLSESQQILKDTARKFFAGESPIAAVRKAMETDTAYDAALWTK |
| Ga0207694_116930772 | 3300025924 | Corn Rhizosphere | MQFGLSESQQILKDTAHKFFAGEIPIAAVRKAMETESAYDA |
| Ga0207686_112383041 | 3300025934 | Miscanthus Rhizosphere | MQFGLSESQQILKDTARKFFAGESPIAAVRKAMETE |
| Ga0207711_106793102 | 3300025941 | Switchgrass Rhizosphere | MQFGLNESQQILQSNARKFFAAECPMSEVRRIAETETA |
| Ga0209377_11066834 | 3300026334 | Soil | MQFGLSESQQILKDTARKFFSGECSMAEVRRVAETATAHDL |
| Ga0257163_10187102 | 3300026359 | Soil | MQFGLSESQEFLKDSARKFFAGECPSAEMRRLMDTD |
| Ga0257158_11159371 | 3300026515 | Soil | MQFGLSESQDFLKDSARKFFAGECPSVEMRRLMETD |
| Ga0209577_108044782 | 3300026552 | Soil | MQFGLSESQQILKDTARKFLAGECPIAAVRKAMETDTA |
| Ga0207765_1067431 | 3300026819 | Tropical Forest Soil | MQFGLNESQEMLRDSLRSFFAGECPMSEVRRLMATDC |
| Ga0209684_10491913 | 3300027527 | Tropical Forest Soil | MQFGLNESQEILKDGARKFFAGECPISEVRRLADTDTAFDA |
| Ga0209735_10242492 | 3300027562 | Forest Soil | MQFGLSESQEFLKDTAHKFFAGECPSAEMRRLMETDTAYDAAL |
| Ga0209736_10364712 | 3300027660 | Forest Soil | MQFGLSEHQEFLKDSARKFFAGECPSAEMRRLVETATAYDAAL |
| Ga0207862_10683912 | 3300027703 | Tropical Forest Soil | MEFGLNESQEILRDSARSFFAGECSINEVRRLMAT |
| Ga0209283_101465543 | 3300027875 | Vadose Zone Soil | MQFGLSESQEILKGSARKFFAGECPISDVRRLMETDTAYDA |
| Ga0209283_106462231 | 3300027875 | Vadose Zone Soil | MQFGLNESQEFLRDSAHKFFAGECPITEVRRLMETDTAFD |
| Ga0209380_106822181 | 3300027889 | Soil | MQFGLSESQQILKNNARKFFSAECPIGEVRRISETAT |
| Ga0209698_114031622 | 3300027911 | Watersheds | MQFGLNESQEILKESARKFFAGECPIAEVRRLMETD |
| Ga0308309_113982472 | 3300028906 | Soil | MQFGLSESQEFLKASARKFFAGECPSAETRRLMET |
| Ga0302177_100262441 | 3300030053 | Palsa | MEFGLNESQLLLRDNARKFFAGECPMEEVRRLMETE |
| Ga0170823_149679432 | 3300031128 | Forest Soil | MQFGLTESQEFLKNSARQFFAGECPSPEMRRLAETDTAYDS |
| Ga0170824_1175508222 | 3300031231 | Forest Soil | MQFGLSESQQILKDTARKFFAGESPIAAIRKAMETE |
| Ga0302325_110757522 | 3300031234 | Palsa | MQFGLSESQQILKTNARKFFAAECPISEVRRIMETDTAQDQKLWRSMAEQV |
| Ga0310888_103905411 | 3300031538 | Soil | MQFGLNESQVILRDSAREFFAGECPPATVRRLIETDA |
| Ga0310686_1012879353 | 3300031708 | Soil | MQFGLSESQEFLKDSARKFFAGECPSTEMRRLMET |
| Ga0310686_1015775611 | 3300031708 | Soil | MEFGLSESQQFLKYNARKFFAGECPMAEVRRIMETD |
| Ga0307476_101954251 | 3300031715 | Hardwood Forest Soil | MQFGLSESQEFLKDSARKFFAGECPAAEVRRLMETE |
| Ga0307476_102411001 | 3300031715 | Hardwood Forest Soil | MQFGLNESQEILRESARKFFAGECPIPEVRRIMDIETAFDAN |
| Ga0307474_115026471 | 3300031718 | Hardwood Forest Soil | MQFGLNESQEILKQNARQFFAGECPMTHVRQLAESKQ |
| Ga0318494_103465781 | 3300031751 | Soil | MQFGLNESQQFLRDSARKFFAGECPIAEVRRLMETD |
| Ga0310917_101004273 | 3300031833 | Soil | MEFGLSESQQLLKDNARKFFAGECPMQEVRRLMETETA |
| Ga0308174_113132431 | 3300031939 | Soil | MQFGLSESQQILKDTARKFFAGECAMADTRKLMETDTAY |
| Ga0310884_103161792 | 3300031944 | Soil | MQFGLNESQVILRDSAREFFAGECPPATVRRLIETDAAHDRAV |
| Ga0318533_103467282 | 3300032059 | Soil | MQFGLSESQQMLKDNARKFFVGECLMEEVRRLMETD |
| Ga0306924_113398371 | 3300032076 | Soil | MQFGLSESQQILKDTSRKFFSGECPVGEVRRLMETE |
| Ga0318577_100150051 | 3300032091 | Soil | MQFGLNESQQFLRDSARKFFAGECQIAEVRRLMET |
| Ga0307471_1022070382 | 3300032180 | Hardwood Forest Soil | MQFGLTESQEFLKNSARKFFAGECPSTEMRRLMETDTAYDV |
| Ga0307471_1027072011 | 3300032180 | Hardwood Forest Soil | MQFGLTESQEFLKNSARQFFAGECPSSEMRRLAET |
| Ga0335078_124367221 | 3300032805 | Soil | MEFGLSESQQLLKENARKFFAGECPMAEVRRQMETSTAYDA |
| Ga0335080_118997461 | 3300032828 | Soil | MNFGLSESQRILKENARKFFINECPMAEVRRIMEETDHAFDAALYRKMA |
| Ga0335070_105280732 | 3300032829 | Soil | MQFGLNESQKILQSNARKFFAAECAPADVRRIMETGTAH |
| Ga0335081_122385091 | 3300032892 | Soil | MQFGLSDSQQLLKENARKFFATECPMAGVRRLMETGTA |
| Ga0310810_103614991 | 3300033412 | Soil | MQFGLSESQQILKDTARKFFAGESPIAAVRKAMETDTAYDAAL |
| Ga0371490_11321141 | 3300033561 | Peat Soil | MQFGLSESQEFLKDSARKFFAGECPSAEMRRVMETD |
| ⦗Top⦘ |