 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F105706 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 38 residues |
| Representative Sequence | KGEQLEKQVAALTAGLQKVSAQLEASKPAPQVVNNP |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 6.00 % |
| % of genes from short scaffolds (< 2000 bps) | 4.00 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (94.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 4.00 |
| PF00487 | FA_desaturase | 2.00 |
| PF03544 | TonB_C | 2.00 |
| PF07690 | MFS_1 | 1.00 |
| PF00285 | Citrate_synt | 1.00 |
| PF12951 | PATR | 1.00 |
| PF13418 | Kelch_4 | 1.00 |
| PF04199 | Cyclase | 1.00 |
| PF03449 | GreA_GreB_N | 1.00 |
| PF14559 | TPR_19 | 1.00 |
| PF09334 | tRNA-synt_1g | 1.00 |
| PF00009 | GTP_EFTU | 1.00 |
| PF13229 | Beta_helix | 1.00 |
| PF04430 | DUF498 | 1.00 |
| PF04679 | DNA_ligase_A_C | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 2.00 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 2.00 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0372 | Citrate synthase | Energy production and conversion [C] | 1.00 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 1.00 |
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 1.00 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 1.00 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.00 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 94.00 % |
| All Organisms | root | All Organisms | 6.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005178|Ga0066688_10442912 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 840 | Open in IMG/M |
| 3300012205|Ga0137362_10034228 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4050 | Open in IMG/M |
| 3300012582|Ga0137358_10150510 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1585 | Open in IMG/M |
| 3300012912|Ga0157306_10003593 | All Organisms → cellular organisms → Bacteria | 2822 | Open in IMG/M |
| 3300019866|Ga0193756_1057481 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 3300032035|Ga0310911_10136893 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1371 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_05494410 | 2170459010 | Grass Soil | AAQQQKQIKALTAGLEKVSAQLEASKPAPQVVNNP |
| INPgaii200_08297742 | 2228664022 | Soil | RDHRKQIAELTAGMQKVSAHLEMNKPAPQTVQSNR |
| INPhiseqgaiiFebDRAFT_1004737531 | 3300000364 | Soil | KAFLEEHRKVEQLEKQVAALTAGLQRVSAQFEVSKSAPPTASNDQ* |
| JGI11643J12802_105185612 | 3300000890 | Soil | DVQQKQIEALTAGLQKVSAQLEVTKLAPQVVNNP* |
| JGI1027J12803_1002874601 | 3300000955 | Soil | EHRKVEQLEKQVEKLTASLQKVSAQIELSRRAPQTVLNNH* |
| Ga0066680_101460664 | 3300005174 | Soil | LKEHRKVEQLEKQVAVLTAGFQKVSAQLELSKSAPRTVRNSQ* |
| Ga0066688_104429121 | 3300005178 | Soil | KEHRKVEQLEKQLAALTAGLQKVSAQFELSKPAPQTVNNP* |
| Ga0066678_108755811 | 3300005181 | Soil | KAFLEEQRTVEELKKQVAALTAGLQKVNAQLEASKSAPQMVNNP* |
| Ga0070674_1017215541 | 3300005356 | Miscanthus Rhizosphere | KEHREVQELKKEVAALTAGLQKVNAELEASKPAPQVVNNP* |
| Ga0070710_109004511 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | PVVSVQELKKQVAALTAGLEKVSAQLELSKSPPQVGNSP* |
| Ga0073909_102994081 | 3300005526 | Surface Soil | QELKKQIEALTAGLQKVSAQLAAGKPAPQVVTNP* |
| Ga0066703_108725412 | 3300005568 | Soil | EQRTVEELKKQVAALTAGLQKVNAQLEASKSAPQMVNNP* |
| Ga0070702_1013670903 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | FEMAIARLQKQIETLTAGLQKVSGELEASEPAPQVVKNP* |
| Ga0070717_109408441 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EEHRTVEELKKEVAALTAGLQKVSTQVEVIETAPRTVNNP* |
| Ga0066656_102079442 | 3300006034 | Soil | ELKKQVAELTAGLQKVSAQLEASKSAPQVVVNSH* |
| Ga0066652_1015020313 | 3300006046 | Soil | LTVQKQIESLNAGLQKVSAQLEASKPAPQVVNNP* |
| Ga0070716_1013350271 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HRKVEQLEKDVAALTSGLQKVSAQLELCKPAAQTVLNDH* |
| Ga0066659_105010021 | 3300006797 | Soil | QLEKQVEALTAGLEKVNAQVGVSKALPHMVLKDR* |
| Ga0075424_1011088222 | 3300006904 | Populus Rhizosphere | EHRKVEQLEKQVAALTTGLQKVSAQLELSKPVPQTALNDQ* |
| Ga0099827_117385071 | 3300009090 | Vadose Zone Soil | EQLEKQVAALTAGLQKVSAQVELSKAASQTVNNP* |
| Ga0066709_1045834462 | 3300009137 | Grasslands Soil | KVEQLEKQLAALTAGLQKVSAQFELSKPAPQTVNNP* |
| Ga0126305_108639041 | 3300010036 | Serpentine Soil | KEHRKVEQLEKEIEALTAGLQKVSAQLEAKKPASQVVTNQ* |
| Ga0099796_103750471 | 3300010159 | Vadose Zone Soil | RQQKQIEALTAGLQKVSAQLDARKPAPQVVKNND* |
| Ga0126376_131707401 | 3300010359 | Tropical Forest Soil | ELQKQIEALTAGLQKVSAQLELSKSATQTALSNH* |
| Ga0126378_132660221 | 3300010361 | Tropical Forest Soil | HREVQELKKQVAALTAGLQKVSAQLELSKAAPQITATDQ* |
| Ga0126377_119337241 | 3300010362 | Tropical Forest Soil | HRKVEQMQKQIDALTAGLQKVSAQLEVSKPSPKTVKNTD* |
| Ga0126381_1022252821 | 3300010376 | Tropical Forest Soil | QLEKQVEALTAGLQKVSAQLEVSKPAPQVVRNKE* |
| Ga0126381_1026430711 | 3300010376 | Tropical Forest Soil | EHRKVEQLEKQVAALTAGLQRVSAQLEVSKSAPPTASNDQ* |
| Ga0126381_1038367551 | 3300010376 | Tropical Forest Soil | EELKKQVAALTAGLQKVSAQLEVSKSTPQTVANSQ* |
| Ga0126383_125736762 | 3300010398 | Tropical Forest Soil | VIIASQQKQIEALTAGLQKVSAQLELNKRTQQNGFE* |
| Ga0137382_104399862 | 3300012200 | Vadose Zone Soil | RTVEELKKQVAALTAGLQKVNAQLEASKSAPQMVNNP* |
| Ga0137382_104956833 | 3300012200 | Vadose Zone Soil | ALQEEQIKALTAGLQKVSAQLEASKPAPQVVENNR* |
| Ga0137365_102853971 | 3300012201 | Vadose Zone Soil | HQQEQIEALTASLQKVSAQLEVNKTAPQIALSNQ* |
| Ga0137363_102503581 | 3300012202 | Vadose Zone Soil | FLEEHRTVEELKKEVAALTEGLQKVSAQLEASKSAPQVVNNP* |
| Ga0137399_109469661 | 3300012203 | Vadose Zone Soil | AHQQKQIDALTAGLQKVSTQLEASKPAPQVVNNP* |
| Ga0137362_100342281 | 3300012205 | Vadose Zone Soil | EHREVQELKKQVAALSVALQKVSAQVEGSKPAPQVVNNP* |
| Ga0137362_116969601 | 3300012205 | Vadose Zone Soil | KEHRTVQELKKEVAALTAGLQKVSARLEAIKPAPRVVNNP* |
| Ga0137376_102341273 | 3300012208 | Vadose Zone Soil | KEHRKVEQLERQVAALTAGLQKVSARVEASGSMPQKIVTNQ* |
| Ga0137379_108417242 | 3300012209 | Vadose Zone Soil | LSSRQQKQIEALAAGLQKVSTLIGANKAAPQMVVNNL* |
| Ga0137378_110848171 | 3300012210 | Vadose Zone Soil | HKAFLEEQRTVEELKKQVAALTAGLQKVNAQLEASKSAPQMVNNP* |
| Ga0137377_117989041 | 3300012211 | Vadose Zone Soil | LKTRIALQEEQIKALTAGLQKVSAQLEVSKPAPQVVNNP* |
| Ga0137370_101916023 | 3300012285 | Vadose Zone Soil | EQLEKKVEALTAGLQKVSAQLELGKSAQQTVGANQ* |
| Ga0137372_101091731 | 3300012350 | Vadose Zone Soil | HRKVEQLEKQIEVLSAGLQKVSAQLEVNTPASQTIPNSQ* |
| Ga0137372_106355602 | 3300012350 | Vadose Zone Soil | DRQQQKQLETVTATLQKVSAQLEASKPAPQVVNNP* |
| Ga0137371_104359671 | 3300012356 | Vadose Zone Soil | KEHKALLEEHRTVEELKKEVAALTLGLRKVSAQLEVSKPAPQVVNNN* |
| Ga0137384_108154911 | 3300012357 | Vadose Zone Soil | QELKKQIAALTAGLQKVNAQLEASKPAPQVVNNP* |
| Ga0137384_113586142 | 3300012357 | Vadose Zone Soil | KEHRKVEQLEKQVAELTAGLQKVSAQLEVSKASPQTVFNNR* |
| Ga0137358_101332362 | 3300012582 | Vadose Zone Soil | FADAQQKQIDALTMGLQKVSAQLEASKPAPQVVNYP* |
| Ga0137358_101505101 | 3300012582 | Vadose Zone Soil | IASLQKQVAALTAGLQKVSAQVEASKPAPQVVNNP* |
| Ga0137358_104589761 | 3300012582 | Vadose Zone Soil | EHRKVEQLEKQVEALTAGLEKVNAQVGVSKALPHMVLKDR* |
| Ga0157306_100035931 | 3300012912 | Soil | VQELKKQVAALTAGLQKVSSQLELSKPAPQTVKNTD* |
| Ga0137395_102005763 | 3300012917 | Vadose Zone Soil | AHQQKQIEALTAGLQKVSTQLEAGKPAPQVVNNP* |
| Ga0137419_103601143 | 3300012925 | Vadose Zone Soil | ALLQEQIEALTAVLQKVSAQLEATKPAPQVVNNP* |
| Ga0137419_115637071 | 3300012925 | Vadose Zone Soil | IARQQRQIEALTAGLQKVSAQLEASKATAQVVNNP* |
| Ga0164303_102836243 | 3300012957 | Soil | HRKVEQLEKQVEALTAGLQKVSAQLEANKPAPRVVNNP* |
| Ga0164301_102786413 | 3300012960 | Soil | NAQQQKRIEALAMSLQKVSAQLEASKPPPQLVVNSQLHR* |
| Ga0164302_103855711 | 3300012961 | Soil | LKEHREVQELKKEVAALTAGLQKVNAEVEASKPAPQVVNNP* |
| Ga0126369_122222471 | 3300012971 | Tropical Forest Soil | VEELKKQVAALTAGLRKVSAQLEPSKSAPETGMNNR* |
| Ga0126369_123368261 | 3300012971 | Tropical Forest Soil | RTVEELKKQVAALTAGLRKVSAQLELSKSTPQTVLNNR* |
| Ga0126369_128264751 | 3300012971 | Tropical Forest Soil | KVEQLERQVEALSASLQEVSTQLELSKSAPQTVQNNH* |
| Ga0134087_100626463 | 3300012977 | Grasslands Soil | AKQEEQIETLTAGLQKVSAQVEASKPALQVVNNP* |
| Ga0164305_100112331 | 3300012989 | Soil | TEQDNQIAALTAGLQKVSAQVEVNRPAPKTVLNDQ* |
| Ga0157372_104891001 | 3300013307 | Corn Rhizosphere | SIARLEQQIEALNVGLQKVSAQLEASNPAPQMVNNP* |
| Ga0137403_108366022 | 3300015264 | Vadose Zone Soil | IARLQEQIEALTAGLQKVSAQLDVSNSARQVVLKNR* |
| Ga0137403_113789232 | 3300015264 | Vadose Zone Soil | KGEQLEKQVAALTAGLQKVSAQLEASKPAPQVVNNP* |
| Ga0132258_108036071 | 3300015371 | Arabidopsis Rhizosphere | KEHQTVQELKGQVAALTAGLQKVSAQIELRKAPQVVNNP* |
| Ga0132257_1032111211 | 3300015373 | Arabidopsis Rhizosphere | VEELKKQVAALTAGLQKVSEQFELNKPAPQTVLNNR* |
| Ga0132255_1025589441 | 3300015374 | Arabidopsis Rhizosphere | KEHREVQELKKEVAALTAGLQKVNAEVEASKPAPQVVNNP* |
| Ga0182035_120553311 | 3300016341 | Soil | VTQRKKQIEAFRAGLQKVSTQLEGSKSAPQVVNNP |
| Ga0184620_100160911 | 3300018051 | Groundwater Sediment | FLEQQRTVEELKKQVAALTAGLQKVSTQLELNKLAPQTVKNDD |
| Ga0184620_100433571 | 3300018051 | Groundwater Sediment | VQELKKQVAAISEMLQEVSAQVQLNKPAPQTVSNDK |
| Ga0184620_101258331 | 3300018051 | Groundwater Sediment | ATHQQEQIEALTAGLQKVSVQLQASKPAPQTVANK |
| Ga0066667_108391312 | 3300018433 | Grasslands Soil | IEQLEKQVQALTAGLQKVSAQLELSKPAVKTVLKNQ |
| Ga0066667_114627171 | 3300018433 | Grasslands Soil | KLARQQKQIEALIAGLQKVNAQMEVSKPIARMALNNP |
| Ga0173479_101693223 | 3300019362 | Soil | MAIARLQKQIETLTAGLQKVSAELEASKPAPQVVKNP |
| Ga0193756_10574812 | 3300019866 | Soil | VDQLEKQIEALTAGLQKVSAQLEANKATPQVVNNP |
| Ga0193713_11706752 | 3300019882 | Soil | KEHRKVEQLEKQVEVLTAGLQKVSAQLEASKPAPQVVNNP |
| Ga0193729_12637721 | 3300019887 | Soil | TEQDNQIAALTAGLQKVSAQVEVNRPAPKTVLNDQ |
| Ga0193726_10789642 | 3300020021 | Soil | RTVEELKKQVAALTAGLQKVSTQLELNKLAPQTVKNDD |
| Ga0193719_102934842 | 3300021344 | Soil | EELKKEVAALTAGLQKVSAQLEVNKPASQVAENNQ |
| Ga0126371_121179901 | 3300021560 | Tropical Forest Soil | EHRKVEELESTVAKLTAAVEKVSAQLELIKSAPQTVLNH |
| Ga0222622_106707431 | 3300022756 | Groundwater Sediment | EHRKVEQLEKQVEVLTAGLQRVSAQIEASKPAPQVVNNP |
| Ga0207700_105234201 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EFLKEHKAFVEEHRTVEELKKEVAALTAGLQKVSTQVEVIETAPRTVNNP |
| Ga0209378_11469652 | 3300026528 | Soil | RTVEELKKQVAALTAGLQKTSAQLEASKPAPQVVSSTP |
| Ga0209056_101207514 | 3300026538 | Soil | TVEELKKQVAALTAGLQKVTAQIEASKPATQVVNNNQ |
| Ga0209577_101325423 | 3300026552 | Soil | EELKKQVAALTAGLQKTGAQLEASKPAPQVVSSTP |
| Ga0209577_106359472 | 3300026552 | Soil | QELKKQIAALTAGLQKVTAQLELSKIAPQTVLNNR |
| Ga0268264_113093361 | 3300028381 | Switchgrass Rhizosphere | EMAIAKLQKQIETLTAGLQKVSAELEASKPAPQVVKNP |
| Ga0307298_102320111 | 3300028717 | Soil | TAAQQQTQIEALTAGLQKVSARLEARRPAPQVVNNP |
| Ga0307290_103360741 | 3300028791 | Soil | LAEEEKQIAALTSGLQKVSAQIETSKTAPRVVANP |
| Ga0170824_1008364592 | 3300031231 | Forest Soil | MPIRQQKQIDALTAGLQKVSAQLEADKPAPQVVNNP |
| Ga0170819_110394941 | 3300031469 | Forest Soil | IASLQKQVEALTAGLQSVSAQLEASKPARQVVSNP |
| Ga0306917_112726662 | 3300031719 | Soil | EEHRTVEELKKQVAALTAGLRKVSAQLELSKSAPQTVMNNR |
| Ga0306925_100097161 | 3300031890 | Soil | TIARLENQVHALTAGLQKLSAQLEVSKPAPQVVNNP |
| Ga0310912_113177391 | 3300031941 | Soil | VEGHRTVEELNKQIAALTAGLRKVSAQLELSKSAPQTVMNNR |
| Ga0310916_106913172 | 3300031942 | Soil | HKAFVEEHRTVEELKKQVAALTAGLRKVSAQLELSKSAPQTVMNNR |
| Ga0310910_103379621 | 3300031946 | Soil | VEEHRTVEELKKQVAALTAGLQKVSAQLEVGKSAPQVVENKV |
| Ga0310911_101368931 | 3300032035 | Soil | KDFEAAITRLEKRIETLTAGLQKVSAQLEASRSAPKVADSNY |
| Ga0310911_108767031 | 3300032035 | Soil | AFVEEHRTVEELKKQVAALTAGLQKVSAQLEVGKSAPQVVENKV |
| Ga0310810_105701262 | 3300033412 | Soil | EELKKQVAALTAGLQKVSAQLEASKAEQQMVANSH |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |