NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105702

Metagenome / Metatranscriptome Family F105702

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105702
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 42 residues
Representative Sequence EANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKT
Number of Associated Samples 93
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.01 %
% of genes near scaffold ends (potentially truncated) 98.00 %
% of genes from short scaffolds (< 2000 bps) 91.00 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(12.000 % of family members)
Environment Ontology (ENVO) Unclassified
(34.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(36.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.71%    β-sheet: 0.00%    Coil/Unstructured: 54.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00488MutS_V 4.00
PF03795YCII 3.00
PF00072Response_reg 2.00
PF02201SWIB 2.00
PF01713Smr 2.00
PF12838Fer4_7 1.00
PF00903Glyoxalase 1.00
PF02423OCD_Mu_crystall 1.00
PF03648Glyco_hydro_67N 1.00
PF13237Fer4_10 1.00
PF02517Rce1-like 1.00
PF14559TPR_19 1.00
PF02371Transposase_20 1.00
PF13428TPR_14 1.00
PF09624DUF2393 1.00
PF01548DEDD_Tnp_IS110 1.00
PF03796DnaB_C 1.00
PF13414TPR_11 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0249DNA mismatch repair ATPase MutSReplication, recombination and repair [L] 4.00
COG1193dsDNA-specific endonuclease/ATPase MutS2Replication, recombination and repair [L] 4.00
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 3.00
COG3547TransposaseMobilome: prophages, transposons [X] 2.00
COG5531DNA-binding SWIB/MDM2 domainChromatin structure and dynamics [B] 2.00
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 1.00
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 1.00
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 1.00
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 1.00
COG3661Alpha-glucuronidaseCarbohydrate transport and metabolism [G] 1.00
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.00 %
UnclassifiedrootN/A13.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10278679All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300004082|Ga0062384_100420559All Organisms → cellular organisms → Bacteria → Acidobacteria866Open in IMG/M
3300004617|Ga0068955_1361532All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300005177|Ga0066690_10507664All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300005180|Ga0066685_10580944All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300005184|Ga0066671_10248487All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300005435|Ga0070714_101581467All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300005548|Ga0070665_102133850All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300005555|Ga0066692_10906125All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300005557|Ga0066704_10254527All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300005578|Ga0068854_101601254Not Available593Open in IMG/M
3300005587|Ga0066654_10282760All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300005616|Ga0068852_101167917All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300005921|Ga0070766_10008779All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter5164Open in IMG/M
3300006059|Ga0075017_101167336All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300006059|Ga0075017_101430724Not Available544Open in IMG/M
3300006173|Ga0070716_101424715Not Available564Open in IMG/M
3300009038|Ga0099829_11720806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300009089|Ga0099828_10438755All Organisms → cellular organisms → Bacteria → Acidobacteria1177Open in IMG/M
3300009137|Ga0066709_103356973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300009522|Ga0116218_1215963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium864Open in IMG/M
3300009522|Ga0116218_1527867All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300009523|Ga0116221_1101643All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1271Open in IMG/M
3300009552|Ga0116138_1031889All Organisms → cellular organisms → Bacteria → Acidobacteria1574Open in IMG/M
3300009621|Ga0116116_1088201All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300009624|Ga0116105_1130616All Organisms → cellular organisms → Bacteria → Acidobacteria652Open in IMG/M
3300009635|Ga0116117_1009266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2572Open in IMG/M
3300009639|Ga0116122_1018890All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2495Open in IMG/M
3300009645|Ga0116106_1191126All Organisms → cellular organisms → Bacteria → Acidobacteria652Open in IMG/M
3300009839|Ga0116223_10343745All Organisms → cellular organisms → Bacteria → Acidobacteria884Open in IMG/M
3300010396|Ga0134126_13099898Not Available501Open in IMG/M
3300011271|Ga0137393_10802718All Organisms → cellular organisms → Bacteria → Acidobacteria804Open in IMG/M
3300012096|Ga0137389_10814594All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium802Open in IMG/M
3300012200|Ga0137382_10419289Not Available945Open in IMG/M
3300012210|Ga0137378_10350803All Organisms → cellular organisms → Bacteria → Acidobacteria1371Open in IMG/M
3300012918|Ga0137396_10417668All Organisms → cellular organisms → Bacteria → Acidobacteria994Open in IMG/M
3300012925|Ga0137419_10056206All Organisms → cellular organisms → Bacteria → Acidobacteria2562Open in IMG/M
3300012925|Ga0137419_11201252All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300014155|Ga0181524_10356524All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300014200|Ga0181526_10646995All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300014495|Ga0182015_10286685Not Available1080Open in IMG/M
3300015245|Ga0137409_10920327All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300016750|Ga0181505_10622273All Organisms → cellular organisms → Bacteria → Acidobacteria798Open in IMG/M
3300017932|Ga0187814_10044671All Organisms → cellular organisms → Bacteria → Acidobacteria1633Open in IMG/M
3300017933|Ga0187801_10058720All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1410Open in IMG/M
3300017935|Ga0187848_10370239All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300017937|Ga0187809_10094408All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300017938|Ga0187854_10204300All Organisms → cellular organisms → Bacteria → Acidobacteria872Open in IMG/M
3300017959|Ga0187779_10565720All Organisms → cellular organisms → Bacteria → Acidobacteria758Open in IMG/M
3300017995|Ga0187816_10114950All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1158Open in IMG/M
3300018002|Ga0187868_1241698All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300018034|Ga0187863_10468698All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300018035|Ga0187875_10562315Not Available603Open in IMG/M
3300018037|Ga0187883_10339315All Organisms → cellular organisms → Bacteria → Acidobacteria768Open in IMG/M
3300018037|Ga0187883_10526361All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300018043|Ga0187887_10383066Not Available830Open in IMG/M
3300018062|Ga0187784_11167368All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300018090|Ga0187770_11464235All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300018433|Ga0066667_11477956Not Available600Open in IMG/M
3300019788|Ga0182028_1149855All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1326Open in IMG/M
3300019888|Ga0193751_1053063All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1735Open in IMG/M
3300020022|Ga0193733_1176075Not Available564Open in IMG/M
3300020199|Ga0179592_10204835All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium894Open in IMG/M
3300020582|Ga0210395_10087272All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2302Open in IMG/M
3300020583|Ga0210401_10358007All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1321Open in IMG/M
3300021168|Ga0210406_11356719All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300021181|Ga0210388_10510047All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1055Open in IMG/M
3300021181|Ga0210388_11124022All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300021433|Ga0210391_11449153All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300021445|Ga0182009_10661325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7563Open in IMG/M
3300022509|Ga0242649_1066341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300022726|Ga0242654_10449356All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300025406|Ga0208035_1019349All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1100Open in IMG/M
3300025448|Ga0208037_1025173All Organisms → cellular organisms → Bacteria → Acidobacteria1338Open in IMG/M
3300025453|Ga0208455_1001253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8338Open in IMG/M
3300025453|Ga0208455_1057559All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium811Open in IMG/M
3300025480|Ga0208688_1057429All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300025506|Ga0208937_1041223All Organisms → cellular organisms → Bacteria → Acidobacteria1103Open in IMG/M
3300025898|Ga0207692_10676561All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300026315|Ga0209686_1115357All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium908Open in IMG/M
3300026351|Ga0257170_1051124All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300026532|Ga0209160_1174996All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300027862|Ga0209701_10263527All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300027889|Ga0209380_10011296All Organisms → cellular organisms → Bacteria → Acidobacteria5174Open in IMG/M
3300027911|Ga0209698_11055765All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300028798|Ga0302222_10188590All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300028906|Ga0308309_11567381All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300029920|Ga0302142_1256347All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300029951|Ga0311371_12476450Not Available529Open in IMG/M
3300030053|Ga0302177_10169554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1219Open in IMG/M
3300030741|Ga0265459_13388026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300031057|Ga0170834_109288914All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300031234|Ga0302325_12159455All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300031446|Ga0170820_17395812All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300031474|Ga0170818_103678996All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300031720|Ga0307469_10051745All Organisms → cellular organisms → Bacteria → Acidobacteria2586Open in IMG/M
3300031962|Ga0307479_10423720All Organisms → cellular organisms → Bacteria → Acidobacteria1315Open in IMG/M
3300033405|Ga0326727_10424569Not Available1203Open in IMG/M
3300033405|Ga0326727_10897132All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland12.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.00%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.00%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.00%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.00%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004617Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022509Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025406Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026351Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-BEnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029920Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1027867913300001356Peatlands SoilIAEISAANRLYLQGGKKTIGASDQERRLQRLQEIMDELMSLTDWKKP*
Ga0062384_10042055923300004082Bog Forest SoilISEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT*
Ga0068955_136153223300004617Peatlands SoilNRLYLQGGKKMIGASDQARRLQRLQEIMDELMSLTDWKKP*
Ga0066690_1050766413300005177SoilEEIAQIAGANRFYLQSGKRTADAADHQRRLQRLQEILDELMSLTDWKKP*
Ga0066685_1058094413300005180SoilVYVQGGRKTPSVATDHERRMQRLEEILDELMSLTDWKKP*
Ga0066671_1024848723300005184SoilAQIAGANRFYLQSGKRTADAADHQRRLQRLQEILDELMSLTDWKKP*
Ga0070714_10158146713300005435Agricultural SoilISAANRQYLEGGKKIPGASDHERRLQRLQEILDELMSLTDWKKP*
Ga0070665_10213385013300005548Switchgrass RhizosphereIREANRLYLQGGKKIPGAADQERRLQRLQEILDELISLTDWKKP*
Ga0066692_1090612523300005555SoilGGKKEPGAASDQERRLQRLQAILDELVSLTDWKRT*
Ga0066704_1025452733300005557SoilEEIAQIREANRLYLQGGKKEPGAASDQERRLQRLQAILDELVSLTDWKRT*
Ga0068854_10160125423300005578Corn RhizosphereGGSKSAVAAADQERRLQRLQAIMDELMSLNDWKKV*
Ga0066654_1028276013300005587SoilIAQIAGANRFYLQSGKRTADAADHQRRLQRLQEILDELMSLTDWKKP*
Ga0068852_10116791733300005616Corn RhizosphereQIREANRLYLQGGKRIPGAADQERRLQRLQEILDELMSLTDWKKP*
Ga0070766_1000877913300005921SoilNRLYLQGGKKLIGASDQERRLQRLQEIMDELMSLTDWKKT*
Ga0075023_10002080933300006041WatershedsHMKGGKKIPGAADHERRLQRLQEILDELMSLTDWKKP*
Ga0075017_10116733623300006059WatershedsLYLQGGKKVIGASDQERRLQRLQEIMDELMSLTDWKKP*
Ga0075017_10143072413300006059WatershedsIRGANRLYLQGGKKVVGAADQERRLQRLQEILDELMLLTDWKKL*
Ga0070716_10142471523300006173Corn, Switchgrass And Miscanthus RhizosphereIREANRLYLQSGKKPPGAADHERRRERLQEIVDELAALTDWKKP*
Ga0099829_1172080623300009038Vadose Zone SoilLQGGKKIIGASDQERRLQRLQEIMDELMSLTDWKKT*
Ga0099828_1043875513300009089Vadose Zone SoilYLQGGKKIIGASDQERRLQRLQEIMDELMSLTDWKKP*
Ga0066709_10335697323300009137Grasslands SoilRNANQLYIQAGKKVLDAAEQERRIQRLQEILDELMSLTDWKKP*
Ga0116218_121596313300009522Peatlands SoilYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKT*
Ga0116218_152786713300009522Peatlands SoilIAEISEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP*
Ga0116221_110164313300009523Peatlands SoilEEIAEISAANRLYLQGGKKTIGASDQERRLQRLQEIMDELMSLTDWKKP*
Ga0116138_103188913300009552PeatlandSAANRLYLQGGKKTIGASDQERRLQRLQEIMDELMSLTDWKKP*
Ga0116116_108820133300009621PeatlandEISEANRLYLQGGKKTIGASDQQRRLQRLQEIMDELMSLTDWKKT*
Ga0116105_113061613300009624PeatlandGGKKLIGASDQERRLQRLQEIMDELMSLTEWKKT*
Ga0116117_100926613300009635PeatlandAEISEANRLYLAGGKKLIGASDQERRLQRLQEIMDELKSLTDWKKT*
Ga0116122_101889013300009639PeatlandQGGKKTIGASDQQRRLQRLQEIMDELMSLTDWKKT*
Ga0116106_119112623300009645PeatlandYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP*
Ga0116223_1034374513300009839Peatlands SoilSEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT*
Ga0134126_1309989813300010396Terrestrial SoilFKGRKKADGAADHQRRLERLQQILYELMSLTDWKKP*
Ga0137393_1080271813300011271Vadose Zone SoilISEANRLYLQGGKKIIGASDQERRLQRLQEIMNELMSLTDWKKT*
Ga0137389_1081459413300012096Vadose Zone SoilSEANRQYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP*
Ga0137382_1041928913300012200Vadose Zone SoilAQIRGANRLYLQGGKKVVGAADQERRLQRLQEILDELMLLTEWKKL*
Ga0137378_1035080363300012210Vadose Zone SoilEANKLHLQSAKTPLAVAEQQRRLQRLQEILDELMALTDWKKT*
Ga0137396_1041766813300012918Vadose Zone SoilANRLYLQGGKKIIGASDQERRLQRLQEIMDELMSLTDWKKT*
Ga0137419_1005620613300012925Vadose Zone SoilLYFEGGKKAVAAADHQRRLERLQAIRDELMSLTDWKKT*
Ga0137419_1120125213300012925Vadose Zone SoilISAANREYTERGKKIPGAADHERRLQRLQEILDELMSLTDWKKQ*
Ga0181524_1035652423300014155BogEIAEISEANRQYLQGGKKPIGASDQERRLQRLQEIMDELMSLTDWKKP*
Ga0181526_1064699523300014200BogEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT*
Ga0182015_1028668513300014495PalsaRLYLQGGKKIPQGSDQERRLQRLQEILDELGALTEWKKL*
Ga0137409_1092032713300015245Vadose Zone SoilGGKKIIGASDQERRLQRLQEIMDELMSLTDWKKT*
Ga0181505_1062227333300016750PeatlandEEIAEISEANRQYLQGGKKMVGASDQERRLQRLQEIMDELMSLTDWKKP
Ga0187814_1004467143300017932Freshwater SedimentEGGKKMVGASDQERRQQRLQEIMDELKSLTDWKKT
Ga0187801_1005872033300017933Freshwater SedimentLKGGKKPPGAPDQERRLQRLQEILDELMSLTDWKKP
Ga0187848_1037023913300017935PeatlandQGGKKTIGASDQQRRLQRLQEIMDELMSLTDWKKT
Ga0187809_1009440813300017937Freshwater SedimentEIAQINAANRLYLQSGKKPPGGADHERRRERLQQILDELVGLTDWKKL
Ga0187854_1020430013300017938PeatlandQGGKKMIGASDQERRLQRLQEIMDELLSLTDWKKP
Ga0187779_1056572033300017959Tropical PeatlandVEIAEISEANRLYLQGGKKVVGASDQERRLQRLQEIMDELMSLTDWKKT
Ga0187816_1011495013300017995Freshwater SedimentYLQGGKKMVGASDQERRLQRLQEIMDELMSLTDWKKT
Ga0187868_124169813300018002PeatlandNRQYLQGGKKTIGASDQERRLQRLQEIMDELSSLTDWKKT
Ga0187863_1046869813300018034PeatlandNRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT
Ga0187875_1056231523300018035PeatlandEANRLYLQGGKKMIGASDQQRRLQRLQEIMDELMSLTEWKKT
Ga0187883_1033931513300018037PeatlandREEIAEISEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKT
Ga0187883_1052636113300018037PeatlandNRLYLQGGKKMVGASDHERRLQRLQEIMDELRSLTDWKKT
Ga0187887_1038306633300018043PeatlandRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT
Ga0187784_1116736813300018062Tropical PeatlandNRLYVQGGKKTIGASDQERRLQRLQEIMDELMSLTDWKKP
Ga0187770_1146423523300018090Tropical PeatlandLYVQGGKKTIGASDQERRLQRLQEIMDELMSLTDWKKP
Ga0066667_1147795613300018433Grasslands SoilLQGGKKVVGAADQERRLQRLQEILDELMLLTEWKKL
Ga0182028_114985543300019788FenYLHGGKKAIGASDQERRLQRLQEIMDELMSLTDWKKT
Ga0193751_105306313300019888SoilEANRQYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT
Ga0193733_117607523300020022SoilRLYLQDGKKAVAAADHQRRLERLQAIRDELRSLTDWKKT
Ga0179592_1020483533300020199Vadose Zone SoilREEIAEISEANRQYLQGGKKMIGASDQERRIQRLQEIMDELMSLTDWKKT
Ga0210395_1008727243300020582SoilEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKT
Ga0210401_1035800743300020583SoilIAEISEANRLYLQGGKKLIGASDQERRLQRLQEIMDELMSLTDWKKT
Ga0210406_1135671913300021168SoilEEIAEISEANRLYLQGGKKIIGASDQERRLQRLQEIMDELMSLTDWKKT
Ga0210388_1051004713300021181SoilKCREEIAEISEANRLYLQGGKKVVGASDQERRLQRLQEIMDELMALTDWKKP
Ga0210388_1112402213300021181SoilMYLQGGKKVVGASDQERRLQRLQEIMDELRSLTDWKKP
Ga0210391_1144915323300021433SoilQGGKKMIGATDQERRLQRLQEIMDELMSLTDWKKT
Ga0182009_1066132513300021445SoilRLYLLGGKRIPGAAEDHQRRMQRLQEIMDELKSLTDWKKT
Ga0242649_106634113300022509SoilRQYLHGGKKKLSGAAGDHQRRLQRLQDILDELMSLTDWKKV
Ga0242654_1044935613300022726SoilLQGGKKIIGASDQERRLQRLQEIMDELMSLTDWKKT
Ga0208035_101934913300025406PeatlandAEISEANRLYLAGGKKLIGASDQERRLQRLQEIMDELKSLTDWKKT
Ga0208037_102517343300025448PeatlandYLQGGKKTIGASDQQRRLQRLQEIMDELMSLTDWKKT
Ga0208455_100125373300025453PeatlandISEANRLYLQGGKKTIGASDQQRRLQRLQEIMDELMSLTDWKKT
Ga0208455_105755913300025453PeatlandSAANRLYLQGGKKTIGASDQERRLQRLQEIMDELMSLTDWKKP
Ga0208688_105742933300025480PeatlandQYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP
Ga0208937_104122343300025506PeatlandANRQYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP
Ga0207692_1067656113300025898Corn, Switchgrass And Miscanthus RhizosphereIAQIREANRLYVQGGDKRPGTAPDQERRLQRLQEILDELMSLTEWKKT
Ga0209686_111535733300026315SoilYIQAGKKVLDAAEQERRIQRLQEILDELMSLTDWKKP
Ga0257170_105112413300026351SoilIAEISEANRQYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP
Ga0209160_117499613300026532SoilIAQIREANRLYLQGGKKEPGAASDQERRLQRLQAILDELVSLTDWKRT
Ga0209701_1026352713300027862Vadose Zone SoilEIAQISEANRLYLQGGKKIPGAADQERRLQRLQEILDELMSLTDWRKQ
Ga0209380_1001129653300027889SoilSEANRLYLQGGKKLIGASDQERRLQRLQEIMDELMSLTDWKKT
Ga0209698_1105576523300027911WatershedsEIAEISAANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP
Ga0302222_1018859013300028798PalsaEANRQYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKT
Ga0308309_1156738113300028906SoilIAQISEANRQYLHGGKKKLSGAAGDHQRRLQRLQDILDELMSLTDWKKL
Ga0302142_125634713300029920BogNRLYLAGGKKMIGAADQERRLQRLQEIMDELMSLTEWKKT
Ga0311371_1247645013300029951PalsaREEIAEISEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTEWKKT
Ga0302177_1016955413300030053PalsaQYLQGGKKAIGASDQERRLQRLQEIMDELMSLTDWKKP
Ga0265459_1338802623300030741SoilREEIAEISEANRLYLQGGKKVVGASDQERRLQRLQEIMDELMALTDWKKP
Ga0170834_10928891413300031057Forest SoilLQGGKKMIGASDQERRIQRLQEIMDELMSLTDWKKT
Ga0302325_1215945523300031234PalsaNRQYLEGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKT
Ga0170820_1739581233300031446Forest SoilQGGSRSVVAAADQERRLQRLQAIMDELMSLTDWKKV
Ga0170818_10367899623300031474Forest SoilEISEANRLYQQGGKRISGSASDQERRVQRVQEILDKIMSLTDWKKP
Ga0307469_1005174513300031720Hardwood Forest SoilIAEISEANRLYLQGGKKMIGASDQERRLQRLQEIMDELMSLTDWKKP
Ga0307479_1042372013300031962Hardwood Forest SoilANRLYLQGGKKIIGASDQERRLQRLQEIMDELMSLTDWKKT
Ga0326727_1042456913300033405Peat SoilAEIAEISEANRLYLQGGKKVIGASDQQRRLQRLQEIMDELMSLTDWKKT
Ga0326727_1089713213300033405Peat SoilEANRLYLEGGKKMIGASDQQRRLQRLQEIMDELMSLTDWKKT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.