| Basic Information | |
|---|---|
| Family ID | F105701 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MAPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAV |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 16.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 96.00 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (42.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.23% β-sheet: 33.80% Coil/Unstructured: 61.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF08352 | oligo_HPY | 82.00 |
| PF00296 | Bac_luciferase | 11.00 |
| PF00005 | ABC_tran | 3.00 |
| PF00528 | BPD_transp_1 | 2.00 |
| PF00873 | ACR_tran | 1.00 |
| PF03551 | PadR | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 11.00 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.00 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.00 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.00 % |
| Unclassified | root | N/A | 23.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004152|Ga0062386_100225927 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300005332|Ga0066388_103570228 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300005332|Ga0066388_106480950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 590 | Open in IMG/M |
| 3300005332|Ga0066388_108782383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 502 | Open in IMG/M |
| 3300005439|Ga0070711_100279873 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300005468|Ga0070707_100565024 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300005535|Ga0070684_101840592 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005538|Ga0070731_10693053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 677 | Open in IMG/M |
| 3300005553|Ga0066695_10607272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300005555|Ga0066692_10682503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 638 | Open in IMG/M |
| 3300005557|Ga0066704_10943464 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005568|Ga0066703_10162027 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300005587|Ga0066654_10342503 | Not Available | 811 | Open in IMG/M |
| 3300005764|Ga0066903_102510653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 998 | Open in IMG/M |
| 3300005841|Ga0068863_102235107 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005921|Ga0070766_10646551 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300006173|Ga0070716_101438231 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006175|Ga0070712_100566500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 958 | Open in IMG/M |
| 3300006796|Ga0066665_11261649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 566 | Open in IMG/M |
| 3300006800|Ga0066660_11027553 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300007255|Ga0099791_10387973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300009012|Ga0066710_102457878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Dietziaceae → Dietzia → Dietzia alimentaria | 754 | Open in IMG/M |
| 3300009089|Ga0099828_11107242 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300009137|Ga0066709_104683542 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010359|Ga0126376_10942294 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300010361|Ga0126378_10359693 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300010376|Ga0126381_104318937 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300010376|Ga0126381_105085504 | Not Available | 504 | Open in IMG/M |
| 3300010398|Ga0126383_10032836 | All Organisms → cellular organisms → Bacteria | 4140 | Open in IMG/M |
| 3300010398|Ga0126383_12241726 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300012200|Ga0137382_10869486 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300012202|Ga0137363_10819817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 789 | Open in IMG/M |
| 3300012356|Ga0137371_11335806 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012361|Ga0137360_11381664 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012944|Ga0137410_10835219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 776 | Open in IMG/M |
| 3300012971|Ga0126369_13442923 | Not Available | 518 | Open in IMG/M |
| 3300013307|Ga0157372_13420739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 505 | Open in IMG/M |
| 3300014156|Ga0181518_10152550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1237 | Open in IMG/M |
| 3300016319|Ga0182033_10375211 | Not Available | 1196 | Open in IMG/M |
| 3300016371|Ga0182034_11262872 | Not Available | 643 | Open in IMG/M |
| 3300016404|Ga0182037_10799605 | Not Available | 813 | Open in IMG/M |
| 3300016404|Ga0182037_10849465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 789 | Open in IMG/M |
| 3300016422|Ga0182039_11778160 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300020580|Ga0210403_10131026 | Not Available | 2044 | Open in IMG/M |
| 3300020580|Ga0210403_10968442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
| 3300020580|Ga0210403_11392869 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300020581|Ga0210399_10782214 | Not Available | 780 | Open in IMG/M |
| 3300020583|Ga0210401_10884100 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300021178|Ga0210408_10761136 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300021181|Ga0210388_10497004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1071 | Open in IMG/M |
| 3300025928|Ga0207700_10806260 | Not Available | 840 | Open in IMG/M |
| 3300026023|Ga0207677_11244586 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300026542|Ga0209805_1067137 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300026550|Ga0209474_10237057 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300027737|Ga0209038_10074965 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300027846|Ga0209180_10605607 | Not Available | 605 | Open in IMG/M |
| 3300027862|Ga0209701_10556396 | Not Available | 615 | Open in IMG/M |
| 3300028673|Ga0257175_1126097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 512 | Open in IMG/M |
| 3300031543|Ga0318516_10280318 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300031543|Ga0318516_10537992 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300031544|Ga0318534_10878330 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031564|Ga0318573_10144242 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300031640|Ga0318555_10411079 | Not Available | 733 | Open in IMG/M |
| 3300031668|Ga0318542_10147510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1167 | Open in IMG/M |
| 3300031668|Ga0318542_10455422 | Not Available | 663 | Open in IMG/M |
| 3300031679|Ga0318561_10015240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → Thermomicrobiaceae → Thermomicrobium → Thermomicrobium roseum | 3459 | Open in IMG/M |
| 3300031681|Ga0318572_10383145 | Not Available | 835 | Open in IMG/M |
| 3300031682|Ga0318560_10304435 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300031724|Ga0318500_10329925 | Not Available | 751 | Open in IMG/M |
| 3300031736|Ga0318501_10088146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → Thermomicrobiaceae → Thermomicrobium → Thermomicrobium roseum | 1529 | Open in IMG/M |
| 3300031748|Ga0318492_10570980 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300031753|Ga0307477_10934136 | Not Available | 571 | Open in IMG/M |
| 3300031765|Ga0318554_10861259 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031778|Ga0318498_10213303 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300031781|Ga0318547_10068371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → Thermomicrobiaceae → Thermomicrobium → Thermomicrobium roseum | 1961 | Open in IMG/M |
| 3300031781|Ga0318547_10218243 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300031792|Ga0318529_10608583 | Not Available | 507 | Open in IMG/M |
| 3300031796|Ga0318576_10621067 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031799|Ga0318565_10191938 | Not Available | 993 | Open in IMG/M |
| 3300031799|Ga0318565_10211401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 943 | Open in IMG/M |
| 3300031819|Ga0318568_10157245 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300031821|Ga0318567_10151121 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300031832|Ga0318499_10124908 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300031833|Ga0310917_10254720 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300031879|Ga0306919_10839955 | Not Available | 705 | Open in IMG/M |
| 3300031910|Ga0306923_11452161 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300031912|Ga0306921_12003430 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031941|Ga0310912_10698785 | Not Available | 786 | Open in IMG/M |
| 3300031954|Ga0306926_11910057 | Not Available | 670 | Open in IMG/M |
| 3300031981|Ga0318531_10025094 | All Organisms → cellular organisms → Bacteria | 2409 | Open in IMG/M |
| 3300031981|Ga0318531_10276496 | Not Available | 758 | Open in IMG/M |
| 3300032009|Ga0318563_10219996 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300032010|Ga0318569_10134300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 1133 | Open in IMG/M |
| 3300032041|Ga0318549_10195554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 907 | Open in IMG/M |
| 3300032052|Ga0318506_10100240 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300032060|Ga0318505_10226478 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300032068|Ga0318553_10329775 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300032076|Ga0306924_11178019 | Not Available | 830 | Open in IMG/M |
| 3300032174|Ga0307470_10491220 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300032205|Ga0307472_100547827 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 42.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1002259273 | 3300004152 | Bog Forest Soil | MVPPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAV |
| Ga0066388_1035702281 | 3300005332 | Tropical Forest Soil | MPPLIEFVDVSKRFVGGLGREGTLALAGFSLAIDAERPSVIAVVGESGSGK |
| Ga0066388_1064809502 | 3300005332 | Tropical Forest Soil | MAPLIEAVDVSKRFAGGLEREGTLALAGLSLAIDAEQPSIIAVVGESGSGK |
| Ga0066388_1087823832 | 3300005332 | Tropical Forest Soil | VAPLIEAVGVSKRFPGWLGRESTLALAPLSFAIHSEQPAVTAVVGESGSGKT |
| Ga0070711_1002798733 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIA |
| Ga0070707_1005650241 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MREMAPLIEAVDVTKRFAGGLGREGTLALAGLSLAIDAEEPSIIAVVGESG |
| Ga0070684_1018405921 | 3300005535 | Corn Rhizosphere | VRAMAPLIEAVDVSKRFAGGLGREGTLALASLSLTIDDARPSIIAVVG |
| Ga0070731_106930532 | 3300005538 | Surface Soil | MSALIEAVDVSKRFAGRFGREATLALAPVSLTIEAGTPRILAVVGESGSGK |
| Ga0066695_106072721 | 3300005553 | Soil | MAPLIEAVDVSKRFAGGLGREGTLALAGLSLAIDAEEPSIIAVVGESG |
| Ga0066692_106825031 | 3300005555 | Soil | MAPLIEAVDVSKRFAGGLGREGTLALAGLSLAIDAEEPSIIAVVGESGSGK |
| Ga0066704_109434641 | 3300005557 | Soil | MMPISHDAMPPLIEAVEVGKRFGGGLGREGTLALAGLSLA |
| Ga0066703_101620272 | 3300005568 | Soil | MAPLIEAVDVSKRFAGGLGREATLALAGLSLAIDAEEPSIIAVVGESGSG |
| Ga0066654_103425032 | 3300005587 | Soil | MPPLIEAVNVGKRFAGGLGREGTLALAGLSLAIDPERPSVIAVVGE |
| Ga0066903_1025106532 | 3300005764 | Tropical Forest Soil | MKPLVEAVALSKRFAGGLGRESTLALAGLSLSIDAEKP |
| Ga0068863_1022351072 | 3300005841 | Switchgrass Rhizosphere | MAPLIEAVDVSKRFAGGFGRESTLALAGLSLAIHAEKPSIIAVVGES |
| Ga0070766_106465512 | 3300005921 | Soil | MTALIEAVDVAKHFPGGLGREGTLALAGLSLAIDAEQPRIIAVVGESG |
| Ga0070716_1014382311 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSLIEAVDVSKRFARGLGRESTLALAGLSLAIHAEKPSIIAVV |
| Ga0070712_1005665002 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MVSLIKAVDVSKRFAGGLGRESRLALAGLSLAIHAEKPS |
| Ga0066665_112616492 | 3300006796 | Soil | MAPLIEAIDASKRFAGGLGREGTLALAGLSLAIGADEPSIIAV |
| Ga0066660_110275531 | 3300006800 | Soil | MAPLIEAVDLSKRFAGGLGREGTLALAGLSLAIDPERPSVIAVVGES |
| Ga0099791_103879732 | 3300007255 | Vadose Zone Soil | MVPLIEAVDVSKRFAGGLGREGTLALAGLSLAINAEEPSI |
| Ga0066710_1024578782 | 3300009012 | Grasslands Soil | MSAPLIEAADVSKRFAARFGRESTLALAGLSLAIDAGKPSIIAVVGE |
| Ga0099828_111072421 | 3300009089 | Vadose Zone Soil | MSQGTSTPLIEAADVSKRFAGRLGRESTLALAGLSLAIHTEKPSIIAVVGESGSGK |
| Ga0066709_1046835421 | 3300009137 | Grasslands Soil | MVPLIEAVDVSKRFPGGLGRESTLALAGLSLAIHAEKPSIIAVVGE |
| Ga0126376_109422941 | 3300010359 | Tropical Forest Soil | LRDAVAPLIEAVDISKRFSGGLGRESTLALAGLSLAIDAAAP |
| Ga0126378_103596931 | 3300010361 | Tropical Forest Soil | MPPLIEFVDVNKRFVGGPGREGTLALARFSLAIDAERPSVIAV |
| Ga0126381_1043189372 | 3300010376 | Tropical Forest Soil | LRDAVAPLIEAVNVSKRFAGGLGRESTLALAGLSLAVHAET |
| Ga0126381_1050855042 | 3300010376 | Tropical Forest Soil | MPPLIEAVKVSKQFASRLGREGTLALAGLSLTIDVDAPRVIAVVGESGS |
| Ga0126383_100328365 | 3300010398 | Tropical Forest Soil | VISLIEAVAVSKRYAGGLGRESTLALAPLSLVIDAERPRVTAVVGESGSGK |
| Ga0126383_122417261 | 3300010398 | Tropical Forest Soil | LRDAVAPLIEAVDISKRFSGGFGRESTLALAGLSLAI |
| Ga0137382_108694861 | 3300012200 | Vadose Zone Soil | MPVSHDAMPPLIEAVKVGKRFGGGLGREGTLALGGLSLAID |
| Ga0137363_108198172 | 3300012202 | Vadose Zone Soil | MSPPLIEAANVSKRFAGGLGREGTLALAGLSLAIDAEKPS |
| Ga0137371_113358061 | 3300012356 | Vadose Zone Soil | MSGPLIEAANVSKRFAGGFGREGTLALAGLSLAIHAEKPSIIAVVG |
| Ga0137360_113816642 | 3300012361 | Vadose Zone Soil | MALLIEAIDVSKRFAGAFRREGTLALAGLSLAIDAEEPSIIAVVG |
| Ga0137410_108352191 | 3300012944 | Vadose Zone Soil | MAPLIEAVDVSKRFAGGLGREGTLALAGLSLAINAEEPSIIAVVGE |
| Ga0126369_134429232 | 3300012971 | Tropical Forest Soil | MPPLIDAVNVSKRFAGRLGREGTLALAGLSLTIDVDAPR |
| Ga0157372_134207391 | 3300013307 | Corn Rhizosphere | MQPLIEAANVGKRFAGGLGREGTLALAGLSLAIDPERPS |
| Ga0181518_101525501 | 3300014156 | Bog | MPPLIEAVDISKRFAGGLGREATLALAGLSLTIDVAAPRV |
| Ga0182033_103752111 | 3300016319 | Soil | VIPLIEAVDVSKRFAAGLGREGTLALAGLSLAIHAEKPSVIAV |
| Ga0182034_112628721 | 3300016371 | Soil | VVPLIEAVDGSKHFAGGMRRESVLALAGLSLAIDAEKPSIIA |
| Ga0182037_107996052 | 3300016404 | Soil | VREWRAIWRDRMVPMIEAVDVSKRFPGGLGREGTLALAGLSLAIHAEKPSIIAVVGESGS |
| Ga0182037_108494652 | 3300016404 | Soil | VIPLIEAANVSKRFTGGLGREGTLALAGLSLAIHVEKPSIIAVVGESGSGK |
| Ga0182039_117781602 | 3300016422 | Soil | VAALIEAVDISKRFDAGLGRETTLALAPLSLAIHTERPALTAVVGESG |
| Ga0210403_101310261 | 3300020580 | Soil | MVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAETP |
| Ga0210403_109684422 | 3300020580 | Soil | MAPLIEAVDVSKRFAGGLGREGTLALAGLSLAIDAEEPS |
| Ga0210403_113928691 | 3300020580 | Soil | MVSLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVVGE |
| Ga0210399_107822142 | 3300020581 | Soil | MVPLIEAVDVSKRFAGRLGRESTLALAGLSLAIHSEKP |
| Ga0210401_108841002 | 3300020583 | Soil | MVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAETPSIIAVVGESGSGK |
| Ga0210408_107611361 | 3300021178 | Soil | MVPLIEAVDVSKRFAGGLGRESTLALAGLSFAIHAEKPSIIAVVGASGSGKPTVA |
| Ga0210388_104970042 | 3300021181 | Soil | MVSLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVVGESGSGK |
| Ga0207700_108062601 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPLIEAVNVGKRFAGGIGREGTLALAGLSLAIDPERPSVIAVVGE |
| Ga0207677_112445862 | 3300026023 | Miscanthus Rhizosphere | MQPLIEAANVGKRFAGGLGREGTLALAGLSLAIDPE |
| Ga0209805_10671373 | 3300026542 | Soil | MVPLIEAVDVSKRFAGGLGREGTLALAGLSLAIHAEKPSI |
| Ga0209474_102370572 | 3300026550 | Soil | MVPLIEAVDVSKRFAGGLGREGTLALAGLSLAIHAEKPSPACCSA |
| Ga0209038_100749651 | 3300027737 | Bog Forest Soil | MVALIEALDVSKRFAHGLGRDSTLALAGLSLAIHAEKPQIIAVVGESGS |
| Ga0209180_106056071 | 3300027846 | Vadose Zone Soil | MNQGTSIPLIEAAEVSKRFAGRLGRESTLALAGLSLAIHT |
| Ga0209701_105563961 | 3300027862 | Vadose Zone Soil | MSPALIEAADVSKRFPGGLGREGTLALAGLSLAIDAEKPSIIAVVGESG |
| Ga0257175_11260971 | 3300028673 | Soil | MAPLIEAAAVSKRFAGGLRRDGTLALAELSLAIGADS |
| Ga0318516_102803182 | 3300031543 | Soil | VIPLIEAVDVSKRFAAGLGREGTLALAGLSLAIHAEK |
| Ga0318516_105379921 | 3300031543 | Soil | MAPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVVGESG |
| Ga0318534_108783302 | 3300031544 | Soil | VIPLIEAVDVSKRFAAGLGREGTLALAGLSLAIHAEKPSVIAVVG |
| Ga0318573_101442421 | 3300031564 | Soil | MWRDPVVPLIEAVNASKRFAGGLGRESTLALAGLTLAIH |
| Ga0318555_104110791 | 3300031640 | Soil | VVPLIEAVNAGKRFAGGLGRESTLALAGLSLAIYAEKAAIIAVVGESGSGKT |
| Ga0318542_101475102 | 3300031668 | Soil | LAPLIEAADVSKRFAGGLGRESTLALAGLSLAIYAEKAA |
| Ga0318542_104554222 | 3300031668 | Soil | MVALIEAIDVSKRFAGGLGREGTLALAGLSLAIDAEKPSIIAVVGE |
| Ga0318561_100152401 | 3300031679 | Soil | MAPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAE |
| Ga0318572_103831452 | 3300031681 | Soil | MVALIEAIDVSKRFAGGLGREGTLALAGLSLAIDAEKPSIIAVV |
| Ga0318560_103044351 | 3300031682 | Soil | MVSLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPS |
| Ga0318500_103299251 | 3300031724 | Soil | VVPLIEAVNVSKRFAGGLGRESTLALAGLSLAIHA |
| Ga0318501_100881463 | 3300031736 | Soil | MPPLIEAVDVSKRFAGRLGREGTLALAGLSLTIDVDAPRVIAVVGESGS |
| Ga0318492_105709802 | 3300031748 | Soil | MWRDPVVPLIEAVNASKRFAGGLGRESTLALAGLTLAIHAEKPSIIAVVGESGSGK |
| Ga0307477_109341361 | 3300031753 | Hardwood Forest Soil | MAPLIEAVGLSKRFAGGLGRESTLALAGLSLAIEAE |
| Ga0318554_108612592 | 3300031765 | Soil | VVPLIEAVNAGKRFAGGLGRESTLALAGLSLAIYAENPAFISV |
| Ga0318498_102133031 | 3300031778 | Soil | MWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVVRE |
| Ga0318547_100683711 | 3300031781 | Soil | MAPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAV |
| Ga0318547_102182432 | 3300031781 | Soil | MWRDPVVPLIEAVDVTKRFAGGLGREGTLALAGLSLAIH |
| Ga0318529_106085832 | 3300031792 | Soil | MPPLIEAVDVSKRFAGRLGREGTLALAGLSLTIDVDAPRVIAVVGESGSG |
| Ga0318576_106210671 | 3300031796 | Soil | MWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVV |
| Ga0318565_101919382 | 3300031799 | Soil | MVALIEAIDVSKRFAGGLGREGTLALAGLSLAIDAEKPS |
| Ga0318565_102114011 | 3300031799 | Soil | VIPLIEAANVSKRFTGGLGREGTLALAGLSLAIHVEK |
| Ga0318568_101572453 | 3300031819 | Soil | MWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEK |
| Ga0318567_101511211 | 3300031821 | Soil | MWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHA |
| Ga0318499_101249082 | 3300031832 | Soil | VVALIEAIDVSKRFAGGLRREGTLALAGLSLAIDAEKPSIIAVV |
| Ga0310917_102547203 | 3300031833 | Soil | VVPLIEAVDGSKHFAGGMRRESVLALAGLSLAIDAEKPSIIAVVGDSG |
| Ga0306919_108399551 | 3300031879 | Soil | LAPLIEAADVSKRFAGGLGRESTLALAGLSLAIYAEKAAIIAVVGESGS |
| Ga0306923_114521611 | 3300031910 | Soil | MTPLIETVSLSKRFAGGLGRESTLALAGLSLAIDATKPSVIAVVGESGSGK |
| Ga0306921_120034302 | 3300031912 | Soil | LRDAVAPLIEAVDISKRFSGGLGRESTLALAGLSLAIDAE |
| Ga0310912_106987851 | 3300031941 | Soil | MAPLIEALDVSKCFAGRLWRESTLALAGLSLTIDSEKP |
| Ga0306926_119100571 | 3300031954 | Soil | VVPLIEAVNAGKRFAGGLGRESTLALAGLSLAIYAE |
| Ga0318531_100250941 | 3300031981 | Soil | MWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSII |
| Ga0318531_102764962 | 3300031981 | Soil | VVALIEAIDVSKRFAGGLRREGTLALAGLSLAIDAEKPSIIAVVGE |
| Ga0318563_102199962 | 3300032009 | Soil | VVALIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVV |
| Ga0318569_101343002 | 3300032010 | Soil | VIPLIEAANVSKRFTGGLGREGTLALAGLSLAIHVEKPSIIAVVGE |
| Ga0318549_101955541 | 3300032041 | Soil | MWRDPVVPLIEAVDVTKRFAGGLGREGTLALAGLSLAIHA |
| Ga0318506_101002403 | 3300032052 | Soil | MWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKP |
| Ga0318505_102264781 | 3300032060 | Soil | MWRDPVVPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHAEKPSIIAVVGESG |
| Ga0318553_103297751 | 3300032068 | Soil | MAPLIEAVDVSKRFAGGLGRESTLALAGLSLAIHA |
| Ga0306924_111780192 | 3300032076 | Soil | VVALIEAIDVSKRFAGGLRREGTLALAGLSLAIDAEKPS |
| Ga0307470_104912201 | 3300032174 | Hardwood Forest Soil | MAPLIEAVDVGKRFAGGLGRESTLALEGLSLAISAERPAIIAVVGE |
| Ga0307472_1005478271 | 3300032205 | Hardwood Forest Soil | MVPLIEAVDVSKRFPGRLGRESTLALAGLSLAIHA |
| ⦗Top⦘ |