NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105698

Metagenome / Metatranscriptome Family F105698

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105698
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 43 residues
Representative Sequence EAGSGDYFLFHYTNVMKNLKISESKFKQDWPKGVSRVKPRA
Number of Associated Samples 87
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.01 %
% of genes near scaffold ends (potentially truncated) 98.00 %
% of genes from short scaffolds (< 2000 bps) 84.00 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(28.000 % of family members)
Environment Ontology (ENVO) Unclassified
(33.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.59%    β-sheet: 0.00%    Coil/Unstructured: 88.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF01035DNA_binding_1 45.00
PF12833HTH_18 25.00
PF02870Methyltransf_1N 10.00
PF00892EamA 5.00
PF13419HAD_2 2.00
PF02805Ada_Zn_binding 1.00
PF03328HpcH_HpaI 1.00
PF13570PQQ_3 1.00
PF13565HTH_32 1.00
PF13620CarboxypepD_reg 1.00
PF07238PilZ 1.00
PF12390Se-cys_synth_N 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 55.00
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 45.00
COG0469Pyruvate kinaseCarbohydrate transport and metabolism [G] 1.00
COG2169Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domainsReplication, recombination and repair [L] 1.00
COG2301Citrate lyase beta subunitCarbohydrate transport and metabolism [G] 1.00
COG38362-keto-3-deoxy-L-rhamnonate aldolase RhmACarbohydrate transport and metabolism [G] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.00 %
UnclassifiedrootN/A3.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_146870All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300001593|JGI12635J15846_10422161All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300004080|Ga0062385_10659601All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300004092|Ga0062389_100094331All Organisms → cellular organisms → Bacteria → Acidobacteria2621Open in IMG/M
3300005172|Ga0066683_10289765All Organisms → cellular organisms → Bacteria → Acidobacteria1017Open in IMG/M
3300005367|Ga0070667_100843540All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300005434|Ga0070709_11412224All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300005444|Ga0070694_101310101All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300005537|Ga0070730_10911195All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300005541|Ga0070733_10314307All Organisms → cellular organisms → Bacteria → Acidobacteria1036Open in IMG/M
3300005542|Ga0070732_10198087All Organisms → cellular organisms → Bacteria → Acidobacteria1200Open in IMG/M
3300005718|Ga0068866_10037317All Organisms → cellular organisms → Bacteria2386Open in IMG/M
3300006046|Ga0066652_100982648All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300006050|Ga0075028_100329177All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300006173|Ga0070716_101566904All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300006176|Ga0070765_100163479All Organisms → cellular organisms → Bacteria1996Open in IMG/M
3300006176|Ga0070765_101187871All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300006800|Ga0066660_10901632All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300006806|Ga0079220_11991968All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300006903|Ga0075426_10647869Not Available790Open in IMG/M
3300007265|Ga0099794_10274031All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300009012|Ga0066710_102775758All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300009093|Ga0105240_12453974All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010043|Ga0126380_11819344All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300010398|Ga0126383_13502336All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300011120|Ga0150983_13938907All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300011269|Ga0137392_10138542All Organisms → cellular organisms → Bacteria1956Open in IMG/M
3300011269|Ga0137392_11228242All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300011270|Ga0137391_10299338All Organisms → cellular organisms → Bacteria → Acidobacteria1388Open in IMG/M
3300011270|Ga0137391_11116246All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300012096|Ga0137389_10018517All Organisms → cellular organisms → Bacteria4846Open in IMG/M
3300012198|Ga0137364_10298433All Organisms → cellular organisms → Bacteria → Acidobacteria1196Open in IMG/M
3300012202|Ga0137363_10478409All Organisms → cellular organisms → Bacteria → Acidobacteria1044Open in IMG/M
3300012202|Ga0137363_10710600All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300012202|Ga0137363_11783095All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012205|Ga0137362_11776514All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300012210|Ga0137378_10966166All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300012210|Ga0137378_11404384All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300012285|Ga0137370_10408526All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300012361|Ga0137360_10088198All Organisms → cellular organisms → Bacteria2345Open in IMG/M
3300012685|Ga0137397_10336428All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300012925|Ga0137419_11352453All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300012930|Ga0137407_10000537All Organisms → cellular organisms → Bacteria25322Open in IMG/M
3300012930|Ga0137407_10029716All Organisms → cellular organisms → Bacteria4243Open in IMG/M
3300012930|Ga0137407_10099405All Organisms → cellular organisms → Bacteria2490Open in IMG/M
3300012931|Ga0153915_11955631All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300012971|Ga0126369_12232884Not Available634Open in IMG/M
3300017943|Ga0187819_10660990All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300020034|Ga0193753_10225687All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300020579|Ga0210407_10057493All Organisms → cellular organisms → Bacteria → Acidobacteria2909Open in IMG/M
3300021086|Ga0179596_10106531All Organisms → cellular organisms → Bacteria → Acidobacteria1282Open in IMG/M
3300021168|Ga0210406_10587513All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300021171|Ga0210405_10320946All Organisms → cellular organisms → Bacteria → Acidobacteria1223Open in IMG/M
3300021178|Ga0210408_11501025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300021180|Ga0210396_11395844All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300021420|Ga0210394_10002077All Organisms → cellular organisms → Bacteria → Acidobacteria28742Open in IMG/M
3300021477|Ga0210398_10273840All Organisms → cellular organisms → Bacteria → Acidobacteria1376Open in IMG/M
3300021478|Ga0210402_10137706All Organisms → cellular organisms → Bacteria2217Open in IMG/M
3300021478|Ga0210402_11436447All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300021478|Ga0210402_11848759All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300021479|Ga0210410_10235856All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300021479|Ga0210410_10954806All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300021559|Ga0210409_10941559All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300022714|Ga0242671_1071473All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300025898|Ga0207692_10879160All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300025906|Ga0207699_11131533All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300025916|Ga0207663_10695281All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300025986|Ga0207658_10697864All Organisms → cellular organisms → Bacteria917Open in IMG/M
3300026035|Ga0207703_11288548All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300026301|Ga0209238_1069409All Organisms → cellular organisms → Bacteria → Acidobacteria1241Open in IMG/M
3300026313|Ga0209761_1032493All Organisms → cellular organisms → Bacteria → Acidobacteria3115Open in IMG/M
3300026508|Ga0257161_1111858All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300026555|Ga0179593_1023485All Organisms → cellular organisms → Bacteria2614Open in IMG/M
3300026557|Ga0179587_10648618All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300027671|Ga0209588_1250825All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300027783|Ga0209448_10224867All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300027846|Ga0209180_10220750All Organisms → cellular organisms → Bacteria → Acidobacteria1092Open in IMG/M
3300027853|Ga0209274_10714751All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300027862|Ga0209701_10364354All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300027875|Ga0209283_10071285All Organisms → cellular organisms → Bacteria2238Open in IMG/M
3300027884|Ga0209275_10541569All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300027903|Ga0209488_10623076All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300027910|Ga0209583_10018409All Organisms → cellular organisms → Bacteria2177Open in IMG/M
3300029636|Ga0222749_10726306All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300030862|Ga0265753_1036522All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300031057|Ga0170834_111662168All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300031231|Ga0170824_103515647All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300031231|Ga0170824_125612505All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300031234|Ga0302325_10266412All Organisms → cellular organisms → Bacteria → Acidobacteria2829Open in IMG/M
3300031446|Ga0170820_13201078All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300031715|Ga0307476_10347036All Organisms → cellular organisms → Bacteria → Acidobacteria1092Open in IMG/M
3300031753|Ga0307477_11056229All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300031754|Ga0307475_11473044All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300031799|Ga0318565_10119105All Organisms → cellular organisms → Bacteria → Acidobacteria1273Open in IMG/M
3300031820|Ga0307473_11127821All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300031962|Ga0307479_10628395All Organisms → cellular organisms → Bacteria → Acidobacteria1055Open in IMG/M
3300031962|Ga0307479_11843236All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300032180|Ga0307471_102896614All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300032205|Ga0307472_100521782All Organisms → cellular organisms → Bacteria1029Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil28.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil8.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.00%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_026903402199352024SoilSSSWLPVQQKFYESGSADYIQFHYSNVMKNLKIPDFRFKPDWPKDVTRVRPGM
JGI12635J15846_1042216113300001593Forest SoilDEASWLPIQQKFFESGSEDYLIFHYTNVMKNLKIGDNQFKQDWPKGVTRTKLRS*
Ga0062385_1065960123300004080Bog Forest SoilPLQQKFYETGAGDYIQFHYTNMMKNLKINESRFKQDWPKNASHEKPRA*
Ga0062389_10009433113300004092Bog Forest SoilYETGAGDYILFHYTNMMKNLKINESEFKQNWPKNASHEKPHV*
Ga0066683_1028976523300005172SoilIQQKFFEAGSGDYVLSHYTNVMKNLKINDAKFKQDWPKSVSRVKPRA*
Ga0070667_10084354013300005367Switchgrass RhizosphereWLPVQQKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGM*
Ga0070709_1141222423300005434Corn, Switchgrass And Miscanthus RhizosphereSGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGI*
Ga0070694_10131010123300005444Corn, Switchgrass And Miscanthus RhizosphereLPVQQKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGM*
Ga0070730_1091119533300005537Surface SoilQQKFFEAGSGDYFLFHYTNEMKNLKVGDKEFKQDWPKGVTRVKPRG*
Ga0070733_1031430723300005541Surface SoilFYETGSGDYIQFHYSSVMKNLKISDSRFKQDWPKDVTRVKPRG*
Ga0070732_1019808713300005542Surface SoilEAGSGDYFLFRYTNTMKNLKIGDGKFKQDWPKNANRVKPRS*
Ga0068866_1003731733300005718Miscanthus RhizosphereKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGM*
Ga0066652_10098264823300006046SoilQQKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGI*
Ga0075028_10032917723300006050WatershedsFEAGSGDYIQFHYSNVMKNLKISDSRFKQDWPKDASRVKPGL*
Ga0070716_10156690423300006173Corn, Switchgrass And Miscanthus RhizosphereAGGDYFLVKYSNMMKNLKISDAKFKQDWPKEANRVKPRS*
Ga0070765_10016347933300006176SoilILFHYTNMMKNLKINESKFKQDWPKNASHEKPHA*
Ga0070765_10118787123300006176SoilIQQKFYETGSGDYILFHYTNALEDLKINESEFKQDWPKNASHEKPHV*
Ga0066660_1090163223300006800SoilGDYFLFHYTNQMKNLKVGDGQFKPNWPKSVTRVKPRG*
Ga0079220_1199196813300006806Agricultural SoilDYIQFHYSNVMKNLKIPDSRFKPDWPKDATRVRPGM*
Ga0075426_1064786913300006903Populus RhizosphereGSGDYFLFHYTNEMKNLKVGDKEFKQDWPKGVTRVKPRG*
Ga0099794_1027403123300007265Vadose Zone SoilAGSGDYFMFHYINAMKNLPLGDVKFKQDWPKGVTRAKPRG*
Ga0066710_10277575813300009012Grasslands SoilQQKFFEAGSGDYFLFHYTNAMKNLKVGDGQFKQDWPKSATRVKPRG
Ga0105240_1245397413300009093Corn RhizosphereSSWLPVQQKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGM*
Ga0126380_1181934413300010043Tropical Forest SoilADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGL*
Ga0126383_1350233613300010398Tropical Forest SoilEAGTGDYFLFHYTNEMKNLQLGDGKFKQDWPKSVSRVKPRG*
Ga0150983_1393890723300011120Forest SoilSGDYFLFHYTNLMKNLKLDDVKFKPDWPKSVQKIKPRG*
Ga0137392_1013854233300011269Vadose Zone SoilSWLPVQQKFFEAASGDYFLFHYTNVMRNLKIGDGPFKQNWPKNVSRIKPRA*
Ga0137392_1122824213300011269Vadose Zone SoilYVLSHYTNVMKNLKINDAKFKQDWPKSVSRVKPRA*
Ga0137391_1029933833300011270Vadose Zone SoilGDYVLSHYTNVMKNLKINDAKFKQDWPKSVSRVKPRA*
Ga0137391_1111624623300011270Vadose Zone SoilEAGSGDYFLFHYTNVMKNLKISESKFKQDWPKGVSRVKPRA*
Ga0137389_1001851763300012096Vadose Zone SoilDYFLVRYSNMVKNLKINDAKFKQDWPKDANRVKPRS*
Ga0137364_1029843323300012198Vadose Zone SoilSGDYFLFHYINAMKNLKIGDGKFKQDWPKSVSRVKPHA*
Ga0137363_1047840913300012202Vadose Zone SoilGDYFLFHYINAMKNLPLGDVKFKQDWPKGVTRVKPRG*
Ga0137363_1071060013300012202Vadose Zone SoilAGSGDYVLSHYTNVMKNLKINDAKFKQDWPKSVSRVKPRA*
Ga0137363_1178309513300012202Vadose Zone SoilSWLPIQQKFFETGAGDYIQFHYSNVMKNLKIPDSRFKQDWPKDVNRVKPRG*
Ga0137362_1177651423300012205Vadose Zone SoilDYFMFHYINAMKNLPLGDVKFKQDWPKGVTRVKPRG*
Ga0137378_1096616613300012210Vadose Zone SoilDYVLSHYTNVMKNLKINDAKFKQDWPKSVSRVKPRA*
Ga0137378_1140438413300012210Vadose Zone SoilAGSGDYVLSHYTNVMKNLKISDAKFKQDWPKSVSRVKPRA*
Ga0137370_1040852623300012285Vadose Zone SoilYFLFHYINAMKNLKIGDGKFKQDWPKSVSRVKPHA*
Ga0137360_1008819813300012361Vadose Zone SoilYFLFHYINAMKNLPLGDVKFKQDWPKGVTRVKPRG*
Ga0137397_1033642823300012685Vadose Zone SoilDYFLVKYSNMMKNLKINDAKFKPDWPKNATHVKPRQ*
Ga0137419_1135245313300012925Vadose Zone SoilGGDYFLVKYSNMMKNLKINDAKFKPDWPKNATHVKPRQ*
Ga0137407_10000537133300012930Vadose Zone SoilMYILFHYSNVMKNLKISDFRFKQDWPKDANRVKPRG*
Ga0137407_1002971613300012930Vadose Zone SoilGSGDYFLFHYTNLMKNLKLGDVKFKPDWPKSVIKIKPRG*
Ga0137407_1009940533300012930Vadose Zone SoilWLPVQQKFFEAGSGDYFLFHYINAMKNLPLGDVKFKQDWPKGVTRVKPRG*
Ga0153915_1195563113300012931Freshwater WetlandsGSGDYFIFHYTNVALNSKIANNRFKPDWPKDVTRIKPRG*
Ga0126369_1223288413300012971Tropical Forest SoilFFEAGSGDYFLFHYTNAMKNLKLGDVKFKQDWPKSVTGVEPRG*
Ga0182037_1105378413300016404SoilGSGDYFLFHYKNLMKNLKLGDVKFKPDWPKGTQKIKPHG
Ga0187819_1066099023300017943Freshwater SedimentEGGSGDYFLFHYMNAMKNLKIPDGKFKQDWPKNVTRVKPRG
Ga0193753_1022568723300020034SoilVDEASWMPIQQKFFEPAEGDYFLFHYSNVKQNLKIDESEFKQDWPKNVSRIKPQK
Ga0210407_1005749313300020579SoilLPIQQKFYETGAGDYILFHYTNMMKNLKINESEFKQNWPKNASHEKPHV
Ga0179596_1010653123300021086Vadose Zone SoilYILFHYSNVMKNLKISDFRFKQDWPKDANRVKPRG
Ga0210406_1058751323300021168SoilETGSGDYILFHYTGMMKNLKINDSRFKQDWPKNASHEKPHG
Ga0210405_1032094613300021171SoilYILFHYTGMMKNLKINDSKFKQDWPKNASHEKPHA
Ga0210408_1150102523300021178SoilSGDYILFHYTSMMKNLKINDSRFKQDWPKNASHEKPHA
Ga0210396_1139584423300021180SoilYILFHYTNMMKNLKINESEFKQNWPKNASHEKPHV
Ga0210394_10002077303300021420SoilASWLPVQQKFYETGAGDYIQFHYTNMMKNLKINESKFKQDWPKNASHEKPHV
Ga0210398_1027384023300021477SoilGDYISFHYTNMMKNLKINESEFKQDWPKNASHEKPHV
Ga0210402_1013770613300021478SoilPVQQKFFEPGSGDYFLFHYTNLMKNLKLGDVKFKPDWPKSVSKIKPRG
Ga0210402_1143644723300021478SoilSWLPIEQKFYEAGSGDYLLFHYTKTMKNLKINGSKFKQDWPKGVSHVKPRG
Ga0210402_1184875913300021478SoilFETGSGDYVLFHYTSMMKNLKIGDDKFKQDWPKGATHVKPHA
Ga0210410_1023585613300021479SoilQQKFYEAAAGDYFLFHYSDIKKNLKINDSKFKQDWPKDVNRVKPRA
Ga0210410_1095480623300021479SoilQQKIFESGSGDYILFHYTSMMKNLKINDSRFKQDWPKNASHEKPHA
Ga0210409_1094155913300021559SoilSWLPVQQKFYETGAGDYIQFHYTNMMKNLKINESKFKQDWPKNASHEKPHV
Ga0242671_107147313300022714SoilWLPIQQKIFESGSGDYILFHYTSMMKNLKINDSKFKQDWPKNASHEKPHA
Ga0207692_1087916023300025898Corn, Switchgrass And Miscanthus RhizosphereKFFETGAGDYIQFHYTNVMKNLKINDSRFKQDWPKDVNRVKPRG
Ga0207699_1113153323300025906Corn, Switchgrass And Miscanthus RhizosphereKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGI
Ga0207663_1069528123300025916Corn, Switchgrass And Miscanthus RhizosphereIDEASWLPIQQKFLESGSEDYLIFHYTNVMKNLKIGDNQFKQDWPKSVIRTKPRS
Ga0207658_1069786413300025986Switchgrass RhizosphereSWLPVQQKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGM
Ga0207703_1128854823300026035Switchgrass RhizosphereQKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGM
Ga0209238_106940913300026301Grasslands SoilFFEAGSGDYFLFHYINAMKNLKIGDAKFKQDWPKSVSRVKPHA
Ga0209761_103249343300026313Grasslands SoilGSGDYFLFHYTNIVKNAQLPDSRFKQDWPKGATRVKPRF
Ga0257161_111185823300026508SoilGDYIQFHYLSVMKNLKINDSRFKQDWPKDANRVKPRG
Ga0179593_102348513300026555Vadose Zone SoilAKFFEAGSGDYFLFHYINAMKNLPLGDVKFKQDWPKGVTRVKPRG
Ga0179587_1064861823300026557Vadose Zone SoilDYFLVKYSNMMKNLKISDAKFKQDWPKDANRVKPRS
Ga0209588_125082523300027671Vadose Zone SoilGSGDYFMFHYINAMKNLPLGDVKFKQDWPKGVTRVKPRG
Ga0209448_1022486723300027783Bog Forest SoilLPVQQKFFEAGSGDYILFHYTNLMKNLKISESRFKQDWPKDATHEKPHG
Ga0209180_1022075023300027846Vadose Zone SoilEAASGDYFLFHYTNVMRNLKIGDGPFKQNWPKNVSRIKPRA
Ga0209274_1071475113300027853SoilSGSGDYILFHYTSLMKNLKINDSKFKQDWPKNASHEKPHA
Ga0209701_1036435423300027862Vadose Zone SoilFYEAGSGDYFVFHYRNLMKNLKIGEPKFKQDWPKGVNRIKPRG
Ga0209283_1007128513300027875Vadose Zone SoilKFLEASGGDYFLVRYSNMVKNLKINDAKFKQDWPKDANRVKPRS
Ga0209275_1054156923300027884SoilFFDTGSGDYIQFHYTNMMKNLKIPDSRFKQDWPKDISHVRPG
Ga0209488_1062307613300027903Vadose Zone SoilKFYEAGSGDYFLFHYTNVMKNLKINESKFKQDWPKGVSRVKPHA
Ga0209583_1001840933300027910WatershedsAAWLPIQLKFYEAGSGDYLILHYTNLLKNLKIGEPKFKQDWPKGVSRIRPRG
Ga0222749_1072630613300029636SoilQKFHETGSGDYIQFHYSNVMKNLKISDSRFKKDWPKDVTRVKPRG
Ga0265753_103652213300030862SoilKFYETGSGDYILFHYTNALEDLKINESEFKQDWPKNASHEKPHV
Ga0170834_11166216813300031057Forest SoilSWLPIQQKFFESGSEDYLIFHYTKVMKNLKIGDNQFKQDWPKGVTRTKPRS
Ga0170824_10351564713300031231Forest SoilDYLIFHYTKVMKNLKIGDNQFKQDWPKGVTRTKPRS
Ga0170824_12561250523300031231Forest SoilSWLPIQQKFFETGAGDYIQFHYTNVMKNLKINDSRFKQDWPKDVNRVKPRG
Ga0302325_1026641243300031234PalsaFEATEGDYIQFHYQDLKKNLKLNDNKFKQDWPKNVTRVKP
Ga0170820_1320107813300031446Forest SoilVFFFFEAGAEDYLIFHYTHVMKNLKIDDGRFKQDWPKGASRTKPRA
Ga0307476_1034703613300031715Hardwood Forest SoilGTGDYFQFHYLNELKNLKIPDAKFKQDWPKGASRVKPHA
Ga0307477_1105622913300031753Hardwood Forest SoilDYFQFHYLNELKNLKIPDAKFKQDWPKGASRVKPHA
Ga0307475_1147304413300031754Hardwood Forest SoilLKFYEAGSGDYLILHYTNLMKNLNIGDAKFKQDWPKGVTRVKPRG
Ga0318565_1011910523300031799SoilYFLFHYTNEMKNLKVSDSQFKQDWPKGVTRVKPSG
Ga0307473_1112782123300031820Hardwood Forest SoilGSGDYLILHYTNLMKNLKIGEPKFKQDWPKGVSRIKPRG
Ga0307479_1062839513300031962Hardwood Forest SoilGSGDYFLFHYTNVIKNLKIGDAKFKQDWPKSVSHVKPRG
Ga0307479_1184323623300031962Hardwood Forest SoilTGSGDYIQFHYANVMKNLKIADSRFKQDWPKDVNRVKPRG
Ga0307471_10289661423300032180Hardwood Forest SoilSWLPAQQKFYESGSADYIQFHYSNVMKNLKIPDSRFKQDWPKDATRVKPGI
Ga0307472_10052178223300032205Hardwood Forest SoilPIQLKFYEAGSGDYLILHYKNLMKNLKIGEPKFKQDWPKGVSRIKPRG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.