NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105683

Metagenome / Metatranscriptome Family F105683

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105683
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 44 residues
Representative Sequence MTYAVNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL
Number of Associated Samples 83
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.00 %
% of genes near scaffold ends (potentially truncated) 94.00 %
% of genes from short scaffolds (< 2000 bps) 93.00 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.000 % of family members)
Environment Ontology (ENVO) Unclassified
(24.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.45%    β-sheet: 22.54%    Coil/Unstructured: 69.01%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF13549ATP-grasp_5 6.00
PF13442Cytochrome_CBB3 4.00
PF00005ABC_tran 3.00
PF12551PHBC_N 2.00
PF00561Abhydrolase_1 1.00
PF01650Peptidase_C13 1.00
PF13358DDE_3 1.00
PF13560HTH_31 1.00
PF03460NIR_SIR_ferr 1.00
PF08681DUF1778 1.00
PF13671AAA_33 1.00
PF00144Beta-lactamase 1.00
PF01850PIN 1.00
PF08450SGL 1.00
PF10984DUF2794 1.00
PF04986Y2_Tnp 1.00
PF01494FAD_binding_3 1.00
PF13620CarboxypepD_reg 1.00
PF02775TPP_enzyme_C 1.00
PF14294DUF4372 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 2.00
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.00
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 1.00
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 1.00
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 1.00
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 1.00
COG2367Beta-lactamase class ADefense mechanisms [V] 1.00
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 1.00
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 1.00
COG4453Uncharacterized conserved protein, DUF1778 familyFunction unknown [S] 1.00
COG5206Glycosylphosphatidylinositol transamidase (GPIT), subunit GPI8Posttranslational modification, protein turnover, chaperones [O] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.00 %
UnclassifiedrootN/A21.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004635|Ga0062388_101055026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales794Open in IMG/M
3300005451|Ga0066681_10445983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales795Open in IMG/M
3300005764|Ga0066903_101123231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1451Open in IMG/M
3300005764|Ga0066903_103179166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales888Open in IMG/M
3300005764|Ga0066903_103936406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales797Open in IMG/M
3300005764|Ga0066903_106282351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria620Open in IMG/M
3300005764|Ga0066903_106541709All Organisms → cellular organisms → Bacteria → Proteobacteria607Open in IMG/M
3300005764|Ga0066903_109133963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales501Open in IMG/M
3300005921|Ga0070766_10097231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1738Open in IMG/M
3300005921|Ga0070766_10563818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria762Open in IMG/M
3300006034|Ga0066656_10544231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales755Open in IMG/M
3300006052|Ga0075029_100573405Not Available751Open in IMG/M
3300006102|Ga0075015_100084497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1569Open in IMG/M
3300006162|Ga0075030_100944509Not Available680Open in IMG/M
3300006174|Ga0075014_100136739All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1183Open in IMG/M
3300006354|Ga0075021_10296348All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300006844|Ga0075428_101402849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales733Open in IMG/M
3300006871|Ga0075434_100703503All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300007265|Ga0099794_10320067Not Available805Open in IMG/M
3300009090|Ga0099827_10191314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1698Open in IMG/M
3300009090|Ga0099827_11769149All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales539Open in IMG/M
3300009683|Ga0116224_10594079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria529Open in IMG/M
3300009698|Ga0116216_10271994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1034Open in IMG/M
3300009698|Ga0116216_10623094Not Available649Open in IMG/M
3300010043|Ga0126380_11355686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae622Open in IMG/M
3300010337|Ga0134062_10410085All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales665Open in IMG/M
3300010360|Ga0126372_10413264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1236Open in IMG/M
3300010360|Ga0126372_12012826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales624Open in IMG/M
3300010360|Ga0126372_12626968Not Available555Open in IMG/M
3300010362|Ga0126377_12825906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales560Open in IMG/M
3300010362|Ga0126377_13110711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales536Open in IMG/M
3300010376|Ga0126381_104361917Not Available547Open in IMG/M
3300010379|Ga0136449_100510709All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2083Open in IMG/M
3300012350|Ga0137372_10393975All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300012362|Ga0137361_10225191All Organisms → cellular organisms → Bacteria1702Open in IMG/M
3300012917|Ga0137395_10620246All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales782Open in IMG/M
3300012944|Ga0137410_10400037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1107Open in IMG/M
3300012971|Ga0126369_13284150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria530Open in IMG/M
3300012976|Ga0134076_10445925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria583Open in IMG/M
3300014157|Ga0134078_10567343Not Available538Open in IMG/M
3300014165|Ga0181523_10546612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales638Open in IMG/M
3300014166|Ga0134079_10223394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales801Open in IMG/M
3300014201|Ga0181537_11242498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300014655|Ga0181516_10715044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria519Open in IMG/M
3300015054|Ga0137420_1473637Not Available4178Open in IMG/M
3300015245|Ga0137409_11297861All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300016270|Ga0182036_10803201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis767Open in IMG/M
3300016319|Ga0182033_10064148All Organisms → cellular organisms → Bacteria → Proteobacteria2556Open in IMG/M
3300016341|Ga0182035_11111402All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300016371|Ga0182034_11380122Not Available616Open in IMG/M
3300016387|Ga0182040_10262841All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300016387|Ga0182040_10987866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria701Open in IMG/M
3300016445|Ga0182038_10432873Not Available1110Open in IMG/M
3300017961|Ga0187778_10385040All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium918Open in IMG/M
3300018044|Ga0187890_10727300All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300018054|Ga0184621_10330185Not Available536Open in IMG/M
3300018058|Ga0187766_10464433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales847Open in IMG/M
3300018062|Ga0187784_10112771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2216Open in IMG/M
3300018086|Ga0187769_10784179All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300018468|Ga0066662_12420904Not Available553Open in IMG/M
3300019879|Ga0193723_1070827Not Available1006Open in IMG/M
3300021080|Ga0210382_10551360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300021171|Ga0210405_10891783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria676Open in IMG/M
3300021432|Ga0210384_10548480All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1040Open in IMG/M
3300021476|Ga0187846_10275066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria698Open in IMG/M
3300021478|Ga0210402_11280419Not Available660Open in IMG/M
3300021478|Ga0210402_11317361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria649Open in IMG/M
3300021479|Ga0210410_11595060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales546Open in IMG/M
3300021858|Ga0213852_1423762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales690Open in IMG/M
3300021861|Ga0213853_11005738Not Available674Open in IMG/M
3300022533|Ga0242662_10127331Not Available751Open in IMG/M
3300025906|Ga0207699_10368104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1018Open in IMG/M
3300026217|Ga0209871_1060334Not Available726Open in IMG/M
3300026361|Ga0257176_1078669All Organisms → cellular organisms → Bacteria → Proteobacteria537Open in IMG/M
3300027840|Ga0209683_10510252Not Available550Open in IMG/M
3300027875|Ga0209283_10738041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria612Open in IMG/M
3300027911|Ga0209698_10879266Not Available673Open in IMG/M
3300030007|Ga0311338_10323641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → unclassified Devosia → Devosia sp. A161691Open in IMG/M
3300031152|Ga0307501_10179063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales594Open in IMG/M
3300031233|Ga0302307_10242098All Organisms → cellular organisms → Bacteria → Proteobacteria927Open in IMG/M
3300031572|Ga0318515_10215881All Organisms → cellular organisms → Bacteria → Proteobacteria1029Open in IMG/M
3300031708|Ga0310686_118257054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300031820|Ga0307473_10857017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales653Open in IMG/M
3300031821|Ga0318567_10193056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1136Open in IMG/M
3300031821|Ga0318567_10368954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria812Open in IMG/M
3300031846|Ga0318512_10166903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1068Open in IMG/M
3300031879|Ga0306919_10101596All Organisms → cellular organisms → Bacteria → Proteobacteria2024Open in IMG/M
3300031890|Ga0306925_11989090All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300031910|Ga0306923_10194485All Organisms → cellular organisms → Bacteria → Proteobacteria2318Open in IMG/M
3300031910|Ga0306923_10794343Not Available1046Open in IMG/M
3300031941|Ga0310912_10434614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1023Open in IMG/M
3300031947|Ga0310909_10112889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2198Open in IMG/M
3300031954|Ga0306926_10342316All Organisms → cellular organisms → Bacteria1849Open in IMG/M
3300032001|Ga0306922_10433534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → unclassified Devosia → Devosia sp. A161406Open in IMG/M
3300032001|Ga0306922_10924814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales904Open in IMG/M
3300032044|Ga0318558_10197386Not Available981Open in IMG/M
3300032044|Ga0318558_10626596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria537Open in IMG/M
3300032064|Ga0318510_10227254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales761Open in IMG/M
3300032261|Ga0306920_100507336All Organisms → cellular organisms → Bacteria → Proteobacteria1790Open in IMG/M
3300032893|Ga0335069_11102370All Organisms → cellular organisms → Bacteria → Proteobacteria875Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds6.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.00%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.00%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.00%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.00%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026361Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-BEnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062388_10105502613300004635Bog Forest SoilLWSFESGTQFAGNPMTYSVNGKQYIALTLGGRPRRDEGSFPEAAAVAQNVMLVVFGL*
Ga0066681_1044598323300005451SoilMTYSVNGKQYIALTLGGRLGRDEGSHPEALTLGQNVILMVFGL*
Ga0066903_10112323133300005764Tropical Forest SoilKQYIALTLGGRPGRDEASFPEAMELGQSVMLMVFGL*
Ga0066903_10317916613300005764Tropical Forest SoilYAVNGKQYVALILGGRLGRDEGSFPEAAQRGQNVILMVFGL*
Ga0066903_10393640623300005764Tropical Forest SoilTYSVNGKQYVALILGGRLGRDEGSFPEAAALGQNVVLMVFGL*
Ga0066903_10628235123300005764Tropical Forest SoilYAVNGKQYIALTLGGRPGRDEGSFPEAAAIGQNVMLMVFGL*
Ga0066903_10654170923300005764Tropical Forest SoilMTYAVNGKQYIALTLGGRPRRDEGSFPEAAEIPQNVMLMVFGL*
Ga0066903_10913396323300005764Tropical Forest SoilYIALTIGGRPARDEGSFPEAMALGQTVMLIVFGL*
Ga0070766_1009723133300005921SoilGTQFAGNPMTYSVNGKQYIALTLGGRPGRDEGSFPEAAAVAQNVMLIVFGL*
Ga0070766_1056381813300005921SoilNGKQYIALTLGGRPARDEGSFPEAMALGQDVMLIVFGL*
Ga0066656_1054423123300006034SoilMTYSVNGKQYIALTLGGRDEGSFPEAAAVGQNVMLMVFGL*
Ga0075029_10057340513300006052WatershedsSFETGTAFAGAPMTYAVNGKQYVALILGGRLGRDEGSFPEAAELGQNVILMVFGL*
Ga0075015_10008449713300006102WatershedsYAVNGKQYIALTLGGRPGRDEGSFPEAAAIAQNVMLVVFGL*
Ga0075030_10094450923300006162WatershedsTYAVNGKQYVALILGGRLGRDEGSFPEAAELGQNVILMVFGL*
Ga0075014_10013673913300006174WatershedsSFETGTAFAGAPMTYAVNGKQYVALILGGRLGRDEGSFPEAAALGQNVILMVFGL*
Ga0075021_1029634813300006354WatershedsNPMTYAVNGKQYVALTLGGRPGRDEGSFPEAAAIGQNVMLMVFGL*
Ga0075428_10140284923300006844Populus RhizospherePMTYSVNGKQYIALTIGGRPARDEGSFPEAMALGQTVMLVVFGL*
Ga0075434_10070350313300006871Populus RhizosphereTGTQFAGNPMTYSVNGKQYIAVTIGGRPARDEGSFPEAMALGQTVMLVVFGL*
Ga0099794_1032006713300007265Vadose Zone SoilTAFAGSPMTYAVNGKQYVALILGGRLGRDEGSFPAAAELGQNVILMVFGL*
Ga0099827_1019131433300009090Vadose Zone SoilETGTAFAGSPMPYSVNGKQYIALTLGGRLSRDGGSFPEALALGQNVILMVFGL*
Ga0099827_1176914913300009090Vadose Zone SoilKQYIALTLGGRPARDEGSFPEAKELGQNVILMVFGL*
Ga0116224_1059407913300009683Peatlands SoilPMTYAVNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILMVFGL*
Ga0116216_1027199413300009698Peatlands SoilNGKQYVALITGGRLGRDEGSFPEAAALGQNVILMVFGL*
Ga0116216_1062309423300009698Peatlands SoilYAVNGKQYIALTLGGRPGRDEGSFPEAAAIAQSVMLVVFGL*
Ga0126380_1135568613300010043Tropical Forest SoilNGKQYIALTLGGRPGRDEGSFPEAAALAQNVMLVVFGL*
Ga0134062_1041008523300010337Grasslands SoilNGKQYIALTLGGRLGRDEGSHPEALALGQNVILMVFGL*
Ga0126372_1041326433300010360Tropical Forest SoilNGKQYIALTLGGRPARDEGSFPEAMALGQTVMLVVFGL*
Ga0126372_1201282623300010360Tropical Forest SoilMTYSVNGKQYIALTIGGRPARDEGSFPEAMALGQTVMLVVFGL*
Ga0126372_1262696813300010360Tropical Forest SoilNPMTYAVYGKQYIALTLGGRPSRDEGTFPEAAAIPQNVMLVVFGL*
Ga0126377_1282590623300010362Tropical Forest SoilTQFAGNPMTYSVNGKQYIGLTIGGRPARDEGSFPEAMALGQTVMLVVFGL*
Ga0126377_1311071123300010362Tropical Forest SoilMTYSVNGKQYIALTIGGRPARDEGSFPEAMALGQTVMLIVFGL*
Ga0126381_10436191713300010376Tropical Forest SoilAFAGSPMTYSVNGKQYVALITGGRLGRDEGSFPEAAQLGQNVILTVFGL*
Ga0136449_10051070953300010379Peatlands SoilGAPMTYSVNGKQYIALVLGGRLGRDEGSFPEAAELGQNVVLMVFGL*
Ga0137372_1039397513300012350Vadose Zone SoilGKQYIALTLGGRPGRDEGSYPEAMALSQNVMLVVFGL*
Ga0137361_1022519123300012362Vadose Zone SoilMQELWSFETGTAFAGSPMTNPVNGKQYIALTLGGRLARDEGSFPEALALGQNVILMVFGL
Ga0137395_1062024613300012917Vadose Zone SoilGKQYVALILGGRLGRDEGSFPEAAQLGQNVILMVFGL*
Ga0137410_1040003713300012944Vadose Zone SoilGKQYVALILGGRLGRDEGSFPEAAELGQNVILMVFGL*
Ga0126369_1328415023300012971Tropical Forest SoilNGKQYVALILGGRLGRDEGSFPEAAQLGQNVTLMVFGL*
Ga0134076_1044592513300012976Grasslands SoilGKQYIALTIGGRPARDEGSFPEAMALGQTVMLVVFGL*
Ga0134078_1056734313300014157Grasslands SoilVNGKQYIALTLGGRPGRDEGSFPEAAAVGQNVMLMVFGL*
Ga0181523_1054661223300014165BogGTAFSGAPMTYSVNGKQYIALILGGRLERDEGSFPEAAALGQNVILMVFGL*
Ga0134079_1022339413300014166Grasslands SoilGNPMTYSVNGKQYIALTLGGRLGRDEGSHPEALTLGQNVILMVFGL*
Ga0181537_1124249823300014201BogYSVNGKQYIALILGGRLGRDEGSFPEAAALGQNVILMVFGL*
Ga0181516_1071504413300014655BogTYSVNGKQYIALILGGRLGRDEGSFPEAAALGQNVILMVFGL*
Ga0137420_147363743300015054Vadose Zone SoilMAGSYIALTLGGRPARDEGSFPEAMALGQDVMLVVFGL*
Ga0137409_1129786123300015245Vadose Zone SoilTYSVNGKQYIALTLGGRPGRDEGSFPEAAAVPQNVILVVFGL*
Ga0182036_1080320113300016270SoilGNPMTYAVNGKQYIALTLGGRPGRDEGSFPEARAVPQNVMLVVFGL
Ga0182033_1006414813300016319SoilTGTQFAGNPMTYAVNGKQYIALTLGGRPGRDEGSFPEARAVPQNVMLVVFGL
Ga0182035_1111140213300016341SoilQYVALTLGGRPGRDEGSFPEAAAVAQNVMLVVFGL
Ga0182034_1138012213300016371SoilFAGSPMTYAVNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL
Ga0182040_1026284123300016387SoilGNPMSYSVNGKQYIALTLGGRPGRDEGSFPEAAAIAQNVMLVVFGL
Ga0182040_1098786613300016387SoilETGTAFAGAPMTYSVNGKQYIALVLGGRLGRDEGSFPEAAALGQNVTLMVFGL
Ga0182038_1043287323300016445SoilGKQYVALTLGGRPGRDEGSFPEAAAVAQNVMLVVFGL
Ga0187778_1038504013300017961Tropical PeatlandKQYIALTLGGRPGRDEGSFPEAAAIPQNVMLVVFGL
Ga0187890_1072730013300018044PeatlandTQFAGNPMTYSVNGKQYIALTLGGRPRRDEGSFPEAAAITQNVMLVVFGL
Ga0184621_1033018513300018054Groundwater SedimentTQFAGNPMTYSVNGKQYIALTLGGRPGRDEGSFPEAAAVGQNVMLMVFGL
Ga0187766_1046443323300018058Tropical PeatlandSPMTYSVNGKQYVALITGGRLGRDEGSFPEAAELGQNVILMVFGL
Ga0187784_1011277113300018062Tropical PeatlandGTAFAGNPMTYAVNGKQYIAVTLGGRLGRDEGSFPEAAGLGQNVILMVFGL
Ga0187769_1078417923300018086Tropical PeatlandGKQYIAVTLGGRLGRDEGSFPEAAGLGQNVILMVFGL
Ga0066662_1242090423300018468Grasslands SoilAGNPMTYSVNGKQYIALTLGGRPGRDEGSFPEAAAIPQNVMLVVFSL
Ga0193723_107082723300019879SoilSVNGKQYIALTLGGRPGRDEGSFPEAAAVGQNVMLMVFGL
Ga0210382_1055136013300021080Groundwater SedimentNGKQYIALTLGGRLGRDEGSHPEALALGQNVILMVFGL
Ga0210405_1089178323300021171SoilSVNGKQYIALTLGGRPARDEGSFPEAKALGQDVMLIVFGL
Ga0210384_1054848013300021432SoilMTYAVNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL
Ga0187846_1027506613300021476BiofilmVNGKQYLALITGGRLGRDEGSFPEAAQLGQNVILMVFGL
Ga0210402_1128041913300021478SoilGKQYVALTLGGRPGRDEGSFPEARAVPQNVMLMVFGL
Ga0210402_1131736123300021478SoilFETGTALAGAPMTYSVNGKQYIALVLGGRLGRDEGSFPEAAALGQNVTLMVFGL
Ga0210410_1159506013300021479SoilYSVNGKQYVALITGGRLGRDEGSFPEAAALGQNVILMVFGL
Ga0213852_142376223300021858WatershedsTYAVNGKQYIALILGGRLGRDEGSYPEAAALGQNVVLMVFGL
Ga0213853_1100573823300021861WatershedsFDTGTAFAGSPMTYAVNGKQYIALILGGRLGRDEGSFPEAAELGQNVILMVFGL
Ga0242662_1012733133300022533SoilSVNGKQYIALVLGGRLGRDEGSFPEAAALGQNVVLMVFGL
Ga0207699_1036810413300025906Corn, Switchgrass And Miscanthus RhizosphereTGTQFAGNPMTYSVNGKQYVALTIGGRPARDEGSFPEAMALGQTVMLVVFGL
Ga0209871_106033413300026217Permafrost SoilMTYSVNGKQYIALTLGGRPGRDEGSFPEARAVPQNVMLVVFGL
Ga0257176_107866913300026361SoilKQYVALILGGRLGRDEGSFPEAAELGQNVILMVFGL
Ga0209683_1051025223300027840Wetland SedimentGTQFSGNPMTYSVNGKQYIALTIGGRPARDEGSFPEAMALGQTVMLVVFGL
Ga0209283_1073804123300027875Vadose Zone SoilMTYAVNGKQYIALILGGRLGRDEGSFPEAAELGQNVILMVFGL
Ga0209698_1087926613300027911WatershedsTYAVNGKQYVALILGGRLGRDEGSFPEAAELGQNVILMVFGL
Ga0311338_1032364113300030007PalsaGSPMTYSVNGKQYVALVLGGRPARDEGSFPEALALGQNVILMVFGL
Ga0307501_1017906323300031152SoilFSGNPMTYSVNGKQYIALTIGGRPARDEGSFPEAMALGQTVMLVVFGL
Ga0302307_1024209843300031233PalsaAGNPMTYSVNGKQYIALTLGGRPRRDEGSFPEAAAITQNVMLVVFGL
Ga0318515_1021588123300031572SoilVHGKQYITLTLGGRPRQNEGSFPEARVVPQNVMLVVFGL
Ga0310686_11825705423300031708SoilGTAFAGAPMTYSVNGKQYIALVLGGRLGRDEGAFPEAAALGQNVVLMVFGL
Ga0307473_1085701713300031820Hardwood Forest SoilTQFAGNPMTYSVNGKQYIALTIGGRPARDEGSFPEAMALGQTVMLVVFGL
Ga0318567_1019305613300031821SoilGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL
Ga0318567_1036895423300031821SoilNGKQYIALTLGGRPGRDEGSFPEARAVPQNVMLVVFGL
Ga0318512_1016690313300031846SoilAFAGSPMTYAVNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL
Ga0306919_1010159623300031879SoilGSPITYAVHGKQYITLTLGGRPRQNEGSFPEARVVPQNVMLVVFGL
Ga0306925_1198909033300031890SoilMSFAVNGRQYVALTLGGRPGRDEGSFPEAAAVAQNVMLVVFGL
Ga0306923_1019448533300031910SoilQYVALILGGRLGRDEGSFPEAAQLGQNVILMVFGL
Ga0306923_1079434323300031910SoilYSVNGKQYIAVTIGGRIGRDEGSFPEASALGQNVMLLVFGL
Ga0310912_1043461413300031941SoilTYAVDGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL
Ga0310909_1011288913300031947SoilQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL
Ga0306926_1034231613300031954SoilQFAGNPMTYAVNGKQYVALTLGGRPGRDEGSFPEAAAVAQNVMVVAFGL
Ga0306922_1043353413300032001SoilWSFETGTAFAGAPMTYSVNGKQYIALVLGGRLGRDEGSFPEAAALGQNVTLMVFGL
Ga0306922_1092481413300032001SoilPMTYAVDGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL
Ga0318558_1019738623300032044SoilKQYIALTLGGRPGRDEGSFPEARAVPQNVMLVVFGL
Ga0318558_1062659623300032044SoilPMTYSVNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL
Ga0318510_1022725413300032064SoilVNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL
Ga0306920_10050733633300032261SoilAGSPMTYAVNGKQYVALILGGRLGRDEGSFPEAAALGQNVVLMVFGL
Ga0335069_1110237013300032893SoilTYAVNGTQYIALTLGGRPRRDEGSFPEAAEIPQNVMLMVFGL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.