| Basic Information | |
|---|---|
| Family ID | F105683 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTYAVNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.00 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.45% β-sheet: 22.54% Coil/Unstructured: 69.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF13549 | ATP-grasp_5 | 6.00 |
| PF13442 | Cytochrome_CBB3 | 4.00 |
| PF00005 | ABC_tran | 3.00 |
| PF12551 | PHBC_N | 2.00 |
| PF00561 | Abhydrolase_1 | 1.00 |
| PF01650 | Peptidase_C13 | 1.00 |
| PF13358 | DDE_3 | 1.00 |
| PF13560 | HTH_31 | 1.00 |
| PF03460 | NIR_SIR_ferr | 1.00 |
| PF08681 | DUF1778 | 1.00 |
| PF13671 | AAA_33 | 1.00 |
| PF00144 | Beta-lactamase | 1.00 |
| PF01850 | PIN | 1.00 |
| PF08450 | SGL | 1.00 |
| PF10984 | DUF2794 | 1.00 |
| PF04986 | Y2_Tnp | 1.00 |
| PF01494 | FAD_binding_3 | 1.00 |
| PF13620 | CarboxypepD_reg | 1.00 |
| PF02775 | TPP_enzyme_C | 1.00 |
| PF14294 | DUF4372 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.00 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.00 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.00 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.00 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.00 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.00 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.00 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.00 |
| COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 1.00 |
| COG5206 | Glycosylphosphatidylinositol transamidase (GPIT), subunit GPI8 | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.00 % |
| Unclassified | root | N/A | 21.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004635|Ga0062388_101055026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 794 | Open in IMG/M |
| 3300005451|Ga0066681_10445983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 795 | Open in IMG/M |
| 3300005764|Ga0066903_101123231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1451 | Open in IMG/M |
| 3300005764|Ga0066903_103179166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 888 | Open in IMG/M |
| 3300005764|Ga0066903_103936406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 797 | Open in IMG/M |
| 3300005764|Ga0066903_106282351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300005764|Ga0066903_106541709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300005764|Ga0066903_109133963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 501 | Open in IMG/M |
| 3300005921|Ga0070766_10097231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1738 | Open in IMG/M |
| 3300005921|Ga0070766_10563818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 762 | Open in IMG/M |
| 3300006034|Ga0066656_10544231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 755 | Open in IMG/M |
| 3300006052|Ga0075029_100573405 | Not Available | 751 | Open in IMG/M |
| 3300006102|Ga0075015_100084497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1569 | Open in IMG/M |
| 3300006162|Ga0075030_100944509 | Not Available | 680 | Open in IMG/M |
| 3300006174|Ga0075014_100136739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1183 | Open in IMG/M |
| 3300006354|Ga0075021_10296348 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300006844|Ga0075428_101402849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 733 | Open in IMG/M |
| 3300006871|Ga0075434_100703503 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300007265|Ga0099794_10320067 | Not Available | 805 | Open in IMG/M |
| 3300009090|Ga0099827_10191314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1698 | Open in IMG/M |
| 3300009090|Ga0099827_11769149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 539 | Open in IMG/M |
| 3300009683|Ga0116224_10594079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300009698|Ga0116216_10271994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1034 | Open in IMG/M |
| 3300009698|Ga0116216_10623094 | Not Available | 649 | Open in IMG/M |
| 3300010043|Ga0126380_11355686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 622 | Open in IMG/M |
| 3300010337|Ga0134062_10410085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 665 | Open in IMG/M |
| 3300010360|Ga0126372_10413264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1236 | Open in IMG/M |
| 3300010360|Ga0126372_12012826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 624 | Open in IMG/M |
| 3300010360|Ga0126372_12626968 | Not Available | 555 | Open in IMG/M |
| 3300010362|Ga0126377_12825906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 560 | Open in IMG/M |
| 3300010362|Ga0126377_13110711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 536 | Open in IMG/M |
| 3300010376|Ga0126381_104361917 | Not Available | 547 | Open in IMG/M |
| 3300010379|Ga0136449_100510709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2083 | Open in IMG/M |
| 3300012350|Ga0137372_10393975 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300012362|Ga0137361_10225191 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
| 3300012917|Ga0137395_10620246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 782 | Open in IMG/M |
| 3300012944|Ga0137410_10400037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1107 | Open in IMG/M |
| 3300012971|Ga0126369_13284150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300012976|Ga0134076_10445925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
| 3300014157|Ga0134078_10567343 | Not Available | 538 | Open in IMG/M |
| 3300014165|Ga0181523_10546612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 638 | Open in IMG/M |
| 3300014166|Ga0134079_10223394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 801 | Open in IMG/M |
| 3300014201|Ga0181537_11242498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 503 | Open in IMG/M |
| 3300014655|Ga0181516_10715044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300015054|Ga0137420_1473637 | Not Available | 4178 | Open in IMG/M |
| 3300015245|Ga0137409_11297861 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300016270|Ga0182036_10803201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 767 | Open in IMG/M |
| 3300016319|Ga0182033_10064148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2556 | Open in IMG/M |
| 3300016341|Ga0182035_11111402 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300016371|Ga0182034_11380122 | Not Available | 616 | Open in IMG/M |
| 3300016387|Ga0182040_10262841 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300016387|Ga0182040_10987866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 701 | Open in IMG/M |
| 3300016445|Ga0182038_10432873 | Not Available | 1110 | Open in IMG/M |
| 3300017961|Ga0187778_10385040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300018044|Ga0187890_10727300 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300018054|Ga0184621_10330185 | Not Available | 536 | Open in IMG/M |
| 3300018058|Ga0187766_10464433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 847 | Open in IMG/M |
| 3300018062|Ga0187784_10112771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2216 | Open in IMG/M |
| 3300018086|Ga0187769_10784179 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300018468|Ga0066662_12420904 | Not Available | 553 | Open in IMG/M |
| 3300019879|Ga0193723_1070827 | Not Available | 1006 | Open in IMG/M |
| 3300021080|Ga0210382_10551360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 511 | Open in IMG/M |
| 3300021171|Ga0210405_10891783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300021432|Ga0210384_10548480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1040 | Open in IMG/M |
| 3300021476|Ga0187846_10275066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 698 | Open in IMG/M |
| 3300021478|Ga0210402_11280419 | Not Available | 660 | Open in IMG/M |
| 3300021478|Ga0210402_11317361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 649 | Open in IMG/M |
| 3300021479|Ga0210410_11595060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 546 | Open in IMG/M |
| 3300021858|Ga0213852_1423762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 690 | Open in IMG/M |
| 3300021861|Ga0213853_11005738 | Not Available | 674 | Open in IMG/M |
| 3300022533|Ga0242662_10127331 | Not Available | 751 | Open in IMG/M |
| 3300025906|Ga0207699_10368104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1018 | Open in IMG/M |
| 3300026217|Ga0209871_1060334 | Not Available | 726 | Open in IMG/M |
| 3300026361|Ga0257176_1078669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300027840|Ga0209683_10510252 | Not Available | 550 | Open in IMG/M |
| 3300027875|Ga0209283_10738041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300027911|Ga0209698_10879266 | Not Available | 673 | Open in IMG/M |
| 3300030007|Ga0311338_10323641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → unclassified Devosia → Devosia sp. A16 | 1691 | Open in IMG/M |
| 3300031152|Ga0307501_10179063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 594 | Open in IMG/M |
| 3300031233|Ga0302307_10242098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 927 | Open in IMG/M |
| 3300031572|Ga0318515_10215881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1029 | Open in IMG/M |
| 3300031708|Ga0310686_118257054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300031820|Ga0307473_10857017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 653 | Open in IMG/M |
| 3300031821|Ga0318567_10193056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1136 | Open in IMG/M |
| 3300031821|Ga0318567_10368954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 812 | Open in IMG/M |
| 3300031846|Ga0318512_10166903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1068 | Open in IMG/M |
| 3300031879|Ga0306919_10101596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2024 | Open in IMG/M |
| 3300031890|Ga0306925_11989090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300031910|Ga0306923_10194485 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2318 | Open in IMG/M |
| 3300031910|Ga0306923_10794343 | Not Available | 1046 | Open in IMG/M |
| 3300031941|Ga0310912_10434614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1023 | Open in IMG/M |
| 3300031947|Ga0310909_10112889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2198 | Open in IMG/M |
| 3300031954|Ga0306926_10342316 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
| 3300032001|Ga0306922_10433534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → unclassified Devosia → Devosia sp. A16 | 1406 | Open in IMG/M |
| 3300032001|Ga0306922_10924814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 904 | Open in IMG/M |
| 3300032044|Ga0318558_10197386 | Not Available | 981 | Open in IMG/M |
| 3300032044|Ga0318558_10626596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300032064|Ga0318510_10227254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 761 | Open in IMG/M |
| 3300032261|Ga0306920_100507336 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1790 | Open in IMG/M |
| 3300032893|Ga0335069_11102370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.00% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.00% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062388_1010550261 | 3300004635 | Bog Forest Soil | LWSFESGTQFAGNPMTYSVNGKQYIALTLGGRPRRDEGSFPEAAAVAQNVMLVVFGL* |
| Ga0066681_104459832 | 3300005451 | Soil | MTYSVNGKQYIALTLGGRLGRDEGSHPEALTLGQNVILMVFGL* |
| Ga0066903_1011232313 | 3300005764 | Tropical Forest Soil | KQYIALTLGGRPGRDEASFPEAMELGQSVMLMVFGL* |
| Ga0066903_1031791661 | 3300005764 | Tropical Forest Soil | YAVNGKQYVALILGGRLGRDEGSFPEAAQRGQNVILMVFGL* |
| Ga0066903_1039364062 | 3300005764 | Tropical Forest Soil | TYSVNGKQYVALILGGRLGRDEGSFPEAAALGQNVVLMVFGL* |
| Ga0066903_1062823512 | 3300005764 | Tropical Forest Soil | YAVNGKQYIALTLGGRPGRDEGSFPEAAAIGQNVMLMVFGL* |
| Ga0066903_1065417092 | 3300005764 | Tropical Forest Soil | MTYAVNGKQYIALTLGGRPRRDEGSFPEAAEIPQNVMLMVFGL* |
| Ga0066903_1091339632 | 3300005764 | Tropical Forest Soil | YIALTIGGRPARDEGSFPEAMALGQTVMLIVFGL* |
| Ga0070766_100972313 | 3300005921 | Soil | GTQFAGNPMTYSVNGKQYIALTLGGRPGRDEGSFPEAAAVAQNVMLIVFGL* |
| Ga0070766_105638181 | 3300005921 | Soil | NGKQYIALTLGGRPARDEGSFPEAMALGQDVMLIVFGL* |
| Ga0066656_105442312 | 3300006034 | Soil | MTYSVNGKQYIALTLGGRDEGSFPEAAAVGQNVMLMVFGL* |
| Ga0075029_1005734051 | 3300006052 | Watersheds | SFETGTAFAGAPMTYAVNGKQYVALILGGRLGRDEGSFPEAAELGQNVILMVFGL* |
| Ga0075015_1000844971 | 3300006102 | Watersheds | YAVNGKQYIALTLGGRPGRDEGSFPEAAAIAQNVMLVVFGL* |
| Ga0075030_1009445092 | 3300006162 | Watersheds | TYAVNGKQYVALILGGRLGRDEGSFPEAAELGQNVILMVFGL* |
| Ga0075014_1001367391 | 3300006174 | Watersheds | SFETGTAFAGAPMTYAVNGKQYVALILGGRLGRDEGSFPEAAALGQNVILMVFGL* |
| Ga0075021_102963481 | 3300006354 | Watersheds | NPMTYAVNGKQYVALTLGGRPGRDEGSFPEAAAIGQNVMLMVFGL* |
| Ga0075428_1014028492 | 3300006844 | Populus Rhizosphere | PMTYSVNGKQYIALTIGGRPARDEGSFPEAMALGQTVMLVVFGL* |
| Ga0075434_1007035031 | 3300006871 | Populus Rhizosphere | TGTQFAGNPMTYSVNGKQYIAVTIGGRPARDEGSFPEAMALGQTVMLVVFGL* |
| Ga0099794_103200671 | 3300007265 | Vadose Zone Soil | TAFAGSPMTYAVNGKQYVALILGGRLGRDEGSFPAAAELGQNVILMVFGL* |
| Ga0099827_101913143 | 3300009090 | Vadose Zone Soil | ETGTAFAGSPMPYSVNGKQYIALTLGGRLSRDGGSFPEALALGQNVILMVFGL* |
| Ga0099827_117691491 | 3300009090 | Vadose Zone Soil | KQYIALTLGGRPARDEGSFPEAKELGQNVILMVFGL* |
| Ga0116224_105940791 | 3300009683 | Peatlands Soil | PMTYAVNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILMVFGL* |
| Ga0116216_102719941 | 3300009698 | Peatlands Soil | NGKQYVALITGGRLGRDEGSFPEAAALGQNVILMVFGL* |
| Ga0116216_106230942 | 3300009698 | Peatlands Soil | YAVNGKQYIALTLGGRPGRDEGSFPEAAAIAQSVMLVVFGL* |
| Ga0126380_113556861 | 3300010043 | Tropical Forest Soil | NGKQYIALTLGGRPGRDEGSFPEAAALAQNVMLVVFGL* |
| Ga0134062_104100852 | 3300010337 | Grasslands Soil | NGKQYIALTLGGRLGRDEGSHPEALALGQNVILMVFGL* |
| Ga0126372_104132643 | 3300010360 | Tropical Forest Soil | NGKQYIALTLGGRPARDEGSFPEAMALGQTVMLVVFGL* |
| Ga0126372_120128262 | 3300010360 | Tropical Forest Soil | MTYSVNGKQYIALTIGGRPARDEGSFPEAMALGQTVMLVVFGL* |
| Ga0126372_126269681 | 3300010360 | Tropical Forest Soil | NPMTYAVYGKQYIALTLGGRPSRDEGTFPEAAAIPQNVMLVVFGL* |
| Ga0126377_128259062 | 3300010362 | Tropical Forest Soil | TQFAGNPMTYSVNGKQYIGLTIGGRPARDEGSFPEAMALGQTVMLVVFGL* |
| Ga0126377_131107112 | 3300010362 | Tropical Forest Soil | MTYSVNGKQYIALTIGGRPARDEGSFPEAMALGQTVMLIVFGL* |
| Ga0126381_1043619171 | 3300010376 | Tropical Forest Soil | AFAGSPMTYSVNGKQYVALITGGRLGRDEGSFPEAAQLGQNVILTVFGL* |
| Ga0136449_1005107095 | 3300010379 | Peatlands Soil | GAPMTYSVNGKQYIALVLGGRLGRDEGSFPEAAELGQNVVLMVFGL* |
| Ga0137372_103939751 | 3300012350 | Vadose Zone Soil | GKQYIALTLGGRPGRDEGSYPEAMALSQNVMLVVFGL* |
| Ga0137361_102251912 | 3300012362 | Vadose Zone Soil | MQELWSFETGTAFAGSPMTNPVNGKQYIALTLGGRLARDEGSFPEALALGQNVILMVFGL |
| Ga0137395_106202461 | 3300012917 | Vadose Zone Soil | GKQYVALILGGRLGRDEGSFPEAAQLGQNVILMVFGL* |
| Ga0137410_104000371 | 3300012944 | Vadose Zone Soil | GKQYVALILGGRLGRDEGSFPEAAELGQNVILMVFGL* |
| Ga0126369_132841502 | 3300012971 | Tropical Forest Soil | NGKQYVALILGGRLGRDEGSFPEAAQLGQNVTLMVFGL* |
| Ga0134076_104459251 | 3300012976 | Grasslands Soil | GKQYIALTIGGRPARDEGSFPEAMALGQTVMLVVFGL* |
| Ga0134078_105673431 | 3300014157 | Grasslands Soil | VNGKQYIALTLGGRPGRDEGSFPEAAAVGQNVMLMVFGL* |
| Ga0181523_105466122 | 3300014165 | Bog | GTAFSGAPMTYSVNGKQYIALILGGRLERDEGSFPEAAALGQNVILMVFGL* |
| Ga0134079_102233941 | 3300014166 | Grasslands Soil | GNPMTYSVNGKQYIALTLGGRLGRDEGSHPEALTLGQNVILMVFGL* |
| Ga0181537_112424982 | 3300014201 | Bog | YSVNGKQYIALILGGRLGRDEGSFPEAAALGQNVILMVFGL* |
| Ga0181516_107150441 | 3300014655 | Bog | TYSVNGKQYIALILGGRLGRDEGSFPEAAALGQNVILMVFGL* |
| Ga0137420_14736374 | 3300015054 | Vadose Zone Soil | MAGSYIALTLGGRPARDEGSFPEAMALGQDVMLVVFGL* |
| Ga0137409_112978612 | 3300015245 | Vadose Zone Soil | TYSVNGKQYIALTLGGRPGRDEGSFPEAAAVPQNVILVVFGL* |
| Ga0182036_108032011 | 3300016270 | Soil | GNPMTYAVNGKQYIALTLGGRPGRDEGSFPEARAVPQNVMLVVFGL |
| Ga0182033_100641481 | 3300016319 | Soil | TGTQFAGNPMTYAVNGKQYIALTLGGRPGRDEGSFPEARAVPQNVMLVVFGL |
| Ga0182035_111114021 | 3300016341 | Soil | QYVALTLGGRPGRDEGSFPEAAAVAQNVMLVVFGL |
| Ga0182034_113801221 | 3300016371 | Soil | FAGSPMTYAVNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL |
| Ga0182040_102628412 | 3300016387 | Soil | GNPMSYSVNGKQYIALTLGGRPGRDEGSFPEAAAIAQNVMLVVFGL |
| Ga0182040_109878661 | 3300016387 | Soil | ETGTAFAGAPMTYSVNGKQYIALVLGGRLGRDEGSFPEAAALGQNVTLMVFGL |
| Ga0182038_104328732 | 3300016445 | Soil | GKQYVALTLGGRPGRDEGSFPEAAAVAQNVMLVVFGL |
| Ga0187778_103850401 | 3300017961 | Tropical Peatland | KQYIALTLGGRPGRDEGSFPEAAAIPQNVMLVVFGL |
| Ga0187890_107273001 | 3300018044 | Peatland | TQFAGNPMTYSVNGKQYIALTLGGRPRRDEGSFPEAAAITQNVMLVVFGL |
| Ga0184621_103301851 | 3300018054 | Groundwater Sediment | TQFAGNPMTYSVNGKQYIALTLGGRPGRDEGSFPEAAAVGQNVMLMVFGL |
| Ga0187766_104644332 | 3300018058 | Tropical Peatland | SPMTYSVNGKQYVALITGGRLGRDEGSFPEAAELGQNVILMVFGL |
| Ga0187784_101127711 | 3300018062 | Tropical Peatland | GTAFAGNPMTYAVNGKQYIAVTLGGRLGRDEGSFPEAAGLGQNVILMVFGL |
| Ga0187769_107841792 | 3300018086 | Tropical Peatland | GKQYIAVTLGGRLGRDEGSFPEAAGLGQNVILMVFGL |
| Ga0066662_124209042 | 3300018468 | Grasslands Soil | AGNPMTYSVNGKQYIALTLGGRPGRDEGSFPEAAAIPQNVMLVVFSL |
| Ga0193723_10708272 | 3300019879 | Soil | SVNGKQYIALTLGGRPGRDEGSFPEAAAVGQNVMLMVFGL |
| Ga0210382_105513601 | 3300021080 | Groundwater Sediment | NGKQYIALTLGGRLGRDEGSHPEALALGQNVILMVFGL |
| Ga0210405_108917832 | 3300021171 | Soil | SVNGKQYIALTLGGRPARDEGSFPEAKALGQDVMLIVFGL |
| Ga0210384_105484801 | 3300021432 | Soil | MTYAVNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL |
| Ga0187846_102750661 | 3300021476 | Biofilm | VNGKQYLALITGGRLGRDEGSFPEAAQLGQNVILMVFGL |
| Ga0210402_112804191 | 3300021478 | Soil | GKQYVALTLGGRPGRDEGSFPEARAVPQNVMLMVFGL |
| Ga0210402_113173612 | 3300021478 | Soil | FETGTALAGAPMTYSVNGKQYIALVLGGRLGRDEGSFPEAAALGQNVTLMVFGL |
| Ga0210410_115950601 | 3300021479 | Soil | YSVNGKQYVALITGGRLGRDEGSFPEAAALGQNVILMVFGL |
| Ga0213852_14237622 | 3300021858 | Watersheds | TYAVNGKQYIALILGGRLGRDEGSYPEAAALGQNVVLMVFGL |
| Ga0213853_110057382 | 3300021861 | Watersheds | FDTGTAFAGSPMTYAVNGKQYIALILGGRLGRDEGSFPEAAELGQNVILMVFGL |
| Ga0242662_101273313 | 3300022533 | Soil | SVNGKQYIALVLGGRLGRDEGSFPEAAALGQNVVLMVFGL |
| Ga0207699_103681041 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TGTQFAGNPMTYSVNGKQYVALTIGGRPARDEGSFPEAMALGQTVMLVVFGL |
| Ga0209871_10603341 | 3300026217 | Permafrost Soil | MTYSVNGKQYIALTLGGRPGRDEGSFPEARAVPQNVMLVVFGL |
| Ga0257176_10786691 | 3300026361 | Soil | KQYVALILGGRLGRDEGSFPEAAELGQNVILMVFGL |
| Ga0209683_105102522 | 3300027840 | Wetland Sediment | GTQFSGNPMTYSVNGKQYIALTIGGRPARDEGSFPEAMALGQTVMLVVFGL |
| Ga0209283_107380412 | 3300027875 | Vadose Zone Soil | MTYAVNGKQYIALILGGRLGRDEGSFPEAAELGQNVILMVFGL |
| Ga0209698_108792661 | 3300027911 | Watersheds | TYAVNGKQYVALILGGRLGRDEGSFPEAAELGQNVILMVFGL |
| Ga0311338_103236411 | 3300030007 | Palsa | GSPMTYSVNGKQYVALVLGGRPARDEGSFPEALALGQNVILMVFGL |
| Ga0307501_101790632 | 3300031152 | Soil | FSGNPMTYSVNGKQYIALTIGGRPARDEGSFPEAMALGQTVMLVVFGL |
| Ga0302307_102420984 | 3300031233 | Palsa | AGNPMTYSVNGKQYIALTLGGRPRRDEGSFPEAAAITQNVMLVVFGL |
| Ga0318515_102158812 | 3300031572 | Soil | VHGKQYITLTLGGRPRQNEGSFPEARVVPQNVMLVVFGL |
| Ga0310686_1182570542 | 3300031708 | Soil | GTAFAGAPMTYSVNGKQYIALVLGGRLGRDEGAFPEAAALGQNVVLMVFGL |
| Ga0307473_108570171 | 3300031820 | Hardwood Forest Soil | TQFAGNPMTYSVNGKQYIALTIGGRPARDEGSFPEAMALGQTVMLVVFGL |
| Ga0318567_101930561 | 3300031821 | Soil | GKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL |
| Ga0318567_103689542 | 3300031821 | Soil | NGKQYIALTLGGRPGRDEGSFPEARAVPQNVMLVVFGL |
| Ga0318512_101669031 | 3300031846 | Soil | AFAGSPMTYAVNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL |
| Ga0306919_101015962 | 3300031879 | Soil | GSPITYAVHGKQYITLTLGGRPRQNEGSFPEARVVPQNVMLVVFGL |
| Ga0306925_119890903 | 3300031890 | Soil | MSFAVNGRQYVALTLGGRPGRDEGSFPEAAAVAQNVMLVVFGL |
| Ga0306923_101944853 | 3300031910 | Soil | QYVALILGGRLGRDEGSFPEAAQLGQNVILMVFGL |
| Ga0306923_107943432 | 3300031910 | Soil | YSVNGKQYIAVTIGGRIGRDEGSFPEASALGQNVMLLVFGL |
| Ga0310912_104346141 | 3300031941 | Soil | TYAVDGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL |
| Ga0310909_101128891 | 3300031947 | Soil | QYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL |
| Ga0306926_103423161 | 3300031954 | Soil | QFAGNPMTYAVNGKQYVALTLGGRPGRDEGSFPEAAAVAQNVMVVAFGL |
| Ga0306922_104335341 | 3300032001 | Soil | WSFETGTAFAGAPMTYSVNGKQYIALVLGGRLGRDEGSFPEAAALGQNVTLMVFGL |
| Ga0306922_109248141 | 3300032001 | Soil | PMTYAVDGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL |
| Ga0318558_101973862 | 3300032044 | Soil | KQYIALTLGGRPGRDEGSFPEARAVPQNVMLVVFGL |
| Ga0318558_106265962 | 3300032044 | Soil | PMTYSVNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL |
| Ga0318510_102272541 | 3300032064 | Soil | VNGKQYIALTLGGRLGRDEGSFPEAAALGQNVILVVFGL |
| Ga0306920_1005073363 | 3300032261 | Soil | AGSPMTYAVNGKQYVALILGGRLGRDEGSFPEAAALGQNVVLMVFGL |
| Ga0335069_111023701 | 3300032893 | Soil | TYAVNGTQYIALTLGGRPRRDEGSFPEAAEIPQNVMLMVFGL |
| ⦗Top⦘ |