| Basic Information | |
|---|---|
| Family ID | F105680 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MELPFGETLPRGGYVVHVDAVGEVAARNLIYRERMQTPGPLQVAVGP |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.00 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.00% β-sheet: 29.33% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00027 | cNMP_binding | 17.00 |
| PF13545 | HTH_Crp_2 | 12.00 |
| PF01408 | GFO_IDH_MocA | 7.00 |
| PF03625 | DUF302 | 5.00 |
| PF07978 | NIPSNAP | 3.00 |
| PF02894 | GFO_IDH_MocA_C | 3.00 |
| PF06026 | Rib_5-P_isom_A | 2.00 |
| PF02687 | FtsX | 2.00 |
| PF00069 | Pkinase | 2.00 |
| PF02656 | DUF202 | 2.00 |
| PF01120 | Alpha_L_fucos | 2.00 |
| PF00072 | Response_reg | 1.00 |
| PF00456 | Transketolase_N | 1.00 |
| PF00795 | CN_hydrolase | 1.00 |
| PF16757 | Fucosidase_C | 1.00 |
| PF00440 | TetR_N | 1.00 |
| PF00596 | Aldolase_II | 1.00 |
| PF02321 | OEP | 1.00 |
| PF12838 | Fer4_7 | 1.00 |
| PF02706 | Wzz | 1.00 |
| PF00325 | Crp | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 8.00 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 5.00 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 3.00 |
| COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 2.00 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
| COG2149 | Uncharacterized membrane protein YidH, DUF202 family | Function unknown [S] | 2.00 |
| COG3669 | Alpha-L-fucosidase | Carbohydrate transport and metabolism [G] | 2.00 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 1.00 |
| COG3206 | Exopolysaccharide export protein/domain GumC/Wzc1 | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG3524 | Capsule polysaccharide export protein KpsE/RkpR | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG3765 | LPS O-antigen chain length determinant protein, WzzB/FepE family | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG3944 | Capsular polysaccharide biosynthesis protein YveK | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.00 % |
| Unclassified | root | N/A | 4.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10251004 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300001546|JGI12659J15293_10122968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300004092|Ga0062389_100753885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1150 | Open in IMG/M |
| 3300004152|Ga0062386_100953728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 710 | Open in IMG/M |
| 3300004631|Ga0058899_11207331 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300005332|Ga0066388_107222014 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005437|Ga0070710_11293885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300005451|Ga0066681_10278831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1019 | Open in IMG/M |
| 3300005530|Ga0070679_100347501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1431 | Open in IMG/M |
| 3300005534|Ga0070735_10826284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 545 | Open in IMG/M |
| 3300005541|Ga0070733_10113806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1735 | Open in IMG/M |
| 3300005541|Ga0070733_10854479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 611 | Open in IMG/M |
| 3300005569|Ga0066705_10558338 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005712|Ga0070764_10465684 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005764|Ga0066903_107656065 | Not Available | 556 | Open in IMG/M |
| 3300005876|Ga0075300_1011477 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300005879|Ga0075295_1004544 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300006162|Ga0075030_100584718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
| 3300006174|Ga0075014_100172840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300006174|Ga0075014_100877566 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 535 | Open in IMG/M |
| 3300006175|Ga0070712_101072093 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300006800|Ga0066660_11480879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300009093|Ga0105240_10337797 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300009520|Ga0116214_1004100 | All Organisms → cellular organisms → Bacteria | 5293 | Open in IMG/M |
| 3300009618|Ga0116127_1144774 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300009628|Ga0116125_1154868 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300009839|Ga0116223_10124155 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300010048|Ga0126373_10578776 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300010048|Ga0126373_13286959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300010360|Ga0126372_11631192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300010366|Ga0126379_11315248 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300010376|Ga0126381_100879372 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300010376|Ga0126381_101481126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300010376|Ga0126381_102442310 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300010376|Ga0126381_104839582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300010398|Ga0126383_12670776 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300011090|Ga0138579_1082976 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300011120|Ga0150983_11478694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300012211|Ga0137377_11793512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300013100|Ga0157373_10407615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300013100|Ga0157373_10928669 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300014200|Ga0181526_10994389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300016387|Ga0182040_10894820 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300016422|Ga0182039_10139480 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300017927|Ga0187824_10274297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300017932|Ga0187814_10404863 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300017943|Ga0187819_10059249 | All Organisms → cellular organisms → Bacteria | 2274 | Open in IMG/M |
| 3300017961|Ga0187778_10476372 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300017974|Ga0187777_10010294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5901 | Open in IMG/M |
| 3300017975|Ga0187782_10350263 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300018007|Ga0187805_10097856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1326 | Open in IMG/M |
| 3300018038|Ga0187855_10351450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300018043|Ga0187887_10363676 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300018062|Ga0187784_11091023 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300018085|Ga0187772_10701840 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300018088|Ga0187771_11490997 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300021088|Ga0210404_10181518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1120 | Open in IMG/M |
| 3300021180|Ga0210396_11750679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300021181|Ga0210388_10491617 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300021402|Ga0210385_10435918 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300021402|Ga0210385_10564134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300021403|Ga0210397_10271703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1237 | Open in IMG/M |
| 3300021432|Ga0210384_11622967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300021475|Ga0210392_10258374 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300021478|Ga0210402_11972271 | Not Available | 510 | Open in IMG/M |
| 3300021479|Ga0210410_10604822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
| 3300021559|Ga0210409_10140563 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
| 3300025898|Ga0207692_10918454 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300025915|Ga0207693_11194319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300025921|Ga0207652_10535193 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300026011|Ga0208532_1003864 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300026555|Ga0179593_1063278 | Not Available | 2656 | Open in IMG/M |
| 3300027432|Ga0209421_1088327 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300027562|Ga0209735_1008804 | All Organisms → cellular organisms → Bacteria | 1922 | Open in IMG/M |
| 3300027575|Ga0209525_1147695 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300027660|Ga0209736_1122708 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300027674|Ga0209118_1058200 | Not Available | 1131 | Open in IMG/M |
| 3300027727|Ga0209328_10075498 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300027854|Ga0209517_10426536 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300027867|Ga0209167_10294960 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300027908|Ga0209006_10309874 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300027911|Ga0209698_10882909 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300028906|Ga0308309_10308243 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300031231|Ga0170824_118124125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300031525|Ga0302326_10552570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1727 | Open in IMG/M |
| 3300031718|Ga0307474_10627244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
| 3300031823|Ga0307478_11700137 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_6 | 520 | Open in IMG/M |
| 3300031962|Ga0307479_10438004 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300031962|Ga0307479_10866739 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300031996|Ga0308176_11296207 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300032044|Ga0318558_10569529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300032076|Ga0306924_10772914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1073 | Open in IMG/M |
| 3300032160|Ga0311301_10645492 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300032160|Ga0311301_11199143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300032180|Ga0307471_100327210 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300032180|Ga0307471_100745077 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300032261|Ga0306920_104392147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300032421|Ga0310812_10059932 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
| 3300032828|Ga0335080_10623892 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300032955|Ga0335076_10638452 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.00% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026011 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_102510041 | 3300001356 | Peatlands Soil | LPRGTLEEELRFGETLPNGGYLVNVDAVGEVEARNLIYRQRMVTPRPLNVNVGP* |
| JGI12659J15293_101229682 | 3300001546 | Forest Soil | GGYMVHVDAVGEVAAKNLIYRERMQTPGPLHVNVGP* |
| Ga0062389_1007538851 | 3300004092 | Bog Forest Soil | AKELPFGENLPHGGYVIHVDAVGEVAPKNLIYRERLQTPGALQVTMGP* |
| Ga0062386_1009537282 | 3300004152 | Bog Forest Soil | TMAMELPFGETLPHGGYVIHVDAVGEVAKKKLIYREYLETPAPLQVTVGP* |
| Ga0058899_112073313 | 3300004631 | Forest Soil | VLRRGTTAMELPFGETLPHGGYVVHVDAVGEVAPKNLIYRERLQTP |
| Ga0066388_1072220142 | 3300005332 | Tropical Forest Soil | TLPRGGYVVHVDAVGEVTPKNVIYRQRMQTPEPLQVMTGP* |
| Ga0070710_112938852 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | QRFMLRRGTVEQELPFGETLPHGGYVVHVDAVGEVAAKNLIYRDRLQTPGALQVSVGP* |
| Ga0066681_102788312 | 3300005451 | Soil | YQRLVLRRGMLEQELPFGETLPRGSYVVHVDAVGEVAAKNLIYRDRMQTPGALQVSVGP* |
| Ga0070679_1003475013 | 3300005530 | Corn Rhizosphere | EQELPFGETLPRGGYVVHVDAVGEVAAKNLIYRDRLQTPGELQVSVGP* |
| Ga0070735_108262842 | 3300005534 | Surface Soil | MELPFGETLPRGGYVVHVDAVGEVAARNLIYRERMQTPGPLQVAVGP* |
| Ga0070733_101138061 | 3300005541 | Surface Soil | PRGGYVVHVDAVGEVAAKRLIYRDRMQTPSALQVTVGP* |
| Ga0070733_108544791 | 3300005541 | Surface Soil | TLPPGAYVVHVDAVGEVAPKRYIYRERMQMPKPLRVIVGP* |
| Ga0066705_105583381 | 3300005569 | Soil | PFGETLPRDGYVVHVDAVGEVPARNIIYRERMQTPSMLQVAVGP* |
| Ga0070764_104656842 | 3300005712 | Soil | HGGYIVHVDAVGEVAAKNVIYREKMDTKALQVVVGP* |
| Ga0066903_1076560652 | 3300005764 | Tropical Forest Soil | GYVVRVDAIGEVSPKNVIYREYLQTASALQVTVGP* |
| Ga0075300_10114772 | 3300005876 | Rice Paddy Soil | GYVVHVDAVGEVSPKNLIYRDRMQTPGQLQVMVGP* |
| Ga0075295_10045441 | 3300005879 | Rice Paddy Soil | PHGGYVVHVDAVGEVSPKNLIYRDRMQTPGQLQVMVGP* |
| Ga0075030_1005847182 | 3300006162 | Watersheds | SKELPFGETLPHGGYVVRVDAVGEVAPKNLIYRENLQTPSALQVVVGP* |
| Ga0075014_1001728402 | 3300006174 | Watersheds | QELPFGETLPRGGYVVHVDAVGEVPAKNIIYRERMQTPSMLQVPVGP* |
| Ga0075014_1008775661 | 3300006174 | Watersheds | YVVHVDAIGEVETRKLIYRERLKTPAPMQVAVGP* |
| Ga0070712_1010720931 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VLRRGAVEQELPFGETLPGGGYVVHVDAVGEVAAKSLIYRDRLQTPGALQVSVGP* |
| Ga0066660_114808791 | 3300006800 | Soil | GGYVVHVDAVGEVAAKNLIYRERMETQGPLQVTVGP* |
| Ga0105240_103377971 | 3300009093 | Corn Rhizosphere | LPRGGYVVHVDAVGEVPAKNLIYRDRLQTPGALQVTLGP* |
| Ga0116214_10041008 | 3300009520 | Peatlands Soil | YLVNVDAVGEVEARNLIYRQRMVTPRPLNVNVGP* |
| Ga0116127_11447742 | 3300009618 | Peatland | ETLPHGGYVVHVDAVGEVAPKNLIYREQMQTPSALQVTVGP* |
| Ga0116125_11548682 | 3300009628 | Peatland | PHGGYVIHVDVVGEVVPKKLIYRERMQTPGPLQVNVGP* |
| Ga0116223_101241553 | 3300009839 | Peatlands Soil | VAKELPFGETLPHGGYVVHVDAVGEVPPRNLIYRVDMKTPGPLQVTVGP* |
| Ga0126373_105787761 | 3300010048 | Tropical Forest Soil | RGGTAAMELPFGDTLPHGGYVVHVDAVGEVPPKNLIYRDRMETPTALQVTVGP* |
| Ga0126373_132869591 | 3300010048 | Tropical Forest Soil | LPFGETLPRGGYVVHVDAIGEVPPRNVIYRERMQTPSALQVNVGP* |
| Ga0126372_116311921 | 3300010360 | Tropical Forest Soil | LPFGETLPRGGYVVHVDAVGEVAARNVIYRERLQTPSMLQVAVGP* |
| Ga0126379_113152482 | 3300010366 | Tropical Forest Soil | RRGTLSQELPFGETLPRGGYVVHVDAVGEVAARNVIYRERLQTPSMLQVAVGP* |
| Ga0126381_1008793721 | 3300010376 | Tropical Forest Soil | GTLGQELPFGDTLPHGAYVVHVDAVGEVAAKNVIYRERMQTPSMLQVNVGP* |
| Ga0126381_1014811262 | 3300010376 | Tropical Forest Soil | GTPAMELPFGDTLPHGGYVVHVDAVGEVAPKNLIYRDRMVTPSALQVTVGP* |
| Ga0126381_1024423101 | 3300010376 | Tropical Forest Soil | GTPAMELPFGDTLPHGGYVVHVDAVGEVAPKNLIYRDRMVTPTTLQVTVGP* |
| Ga0126381_1048395821 | 3300010376 | Tropical Forest Soil | LRRGTFDMELPFGDTLSRGGYVVHVDAIGEVAPRNVIYRERMQTPSALQVNVGP* |
| Ga0126383_126707762 | 3300010398 | Tropical Forest Soil | PFGETLPHGGYVVHVDAVGEVTARNVIHRQRLETLSPLQVTVGP* |
| Ga0138579_10829762 | 3300011090 | Peatlands Soil | EEELRFGETLPNGGYLVNLDAVGEVEARNLIYRQRMVTPRPLNVNVGP* |
| Ga0150983_114786942 | 3300011120 | Forest Soil | VAKELPFGETLPHGGYVVNVDAVGEVAPRKLIYRADLKTPGPLQVTVGP* |
| Ga0137377_117935121 | 3300012211 | Vadose Zone Soil | VGQELPFGETLPRDGYVVHVDAVGEVPARNIIYRERMQTPSMLQVAVGP* |
| Ga0157373_104076151 | 3300013100 | Corn Rhizosphere | HGGYVVHVDAVGEVSPKNLIYRDRIQTPGQLQVAMGP* |
| Ga0157373_109286691 | 3300013100 | Corn Rhizosphere | QELPFGETLPRGGYVVHVDAVGEVAAKNLIYRDRLQTPGELQVSVGP* |
| Ga0181526_109943891 | 3300014200 | Bog | MELPFGETLPHGGYVVHVDAVGEVAAKNLIYREYLETPGPLQVMVGP* |
| Ga0182040_108948202 | 3300016387 | Soil | LPHGGYVVHVDAIGEVAARNVIYRERMQTPSMLQVTVGP |
| Ga0182039_101394801 | 3300016422 | Soil | LAQELPFGETLPRGGYVVHVDAVGEVPPRNVIYRERMQTPTMLQVAVGP |
| Ga0187824_102742971 | 3300017927 | Freshwater Sediment | IAKELPFGETLPRGGYVVHVDVVGEVAAKKQIYRERLQTPSALQVTATP |
| Ga0187814_104048632 | 3300017932 | Freshwater Sediment | MELPFGENLPHGGYTIYVDAVGEVIPKNVIYREQMQTQSQLHVTVGP |
| Ga0187819_100592491 | 3300017943 | Freshwater Sediment | PRGGYVVHVDAVGEVAARNVIYRERMQTPSMLQVTVGP |
| Ga0187778_104763722 | 3300017961 | Tropical Peatland | AKELPFGETLPHGGYVVHVDAIGEVIPRKLIYRERLQTGGPLQVTVGP |
| Ga0187777_100102941 | 3300017974 | Tropical Peatland | KKELPFGETLPRGGYVVHVDAIGEVEAKNLIYRERMATPRPLTVAVE |
| Ga0187782_103502632 | 3300017975 | Tropical Peatland | PHGGYVVHVDAVGEVVPQKLIYRERMQTAGALQVTVGP |
| Ga0187805_100978563 | 3300018007 | Freshwater Sediment | TLPRGGYVVHVDAVGEVAPKNLIYRERMETPGPLQVTIGP |
| Ga0187855_103514502 | 3300018038 | Peatland | GYVIHVDVVGEVVPKKLIYRERMQTPGPLQVNVGP |
| Ga0187887_103636761 | 3300018043 | Peatland | KTVELPFGESLPRGGYKVHVDAVGEVAAKKVIYREYLDAPGQLQVTAQ |
| Ga0187784_110910232 | 3300018062 | Tropical Peatland | FGDTLPHGGYVVHVDAVGEVPPKNLIYRDWMETPAALQVTVGP |
| Ga0187772_107018402 | 3300018085 | Tropical Peatland | FVLRRGTIAKELPFGETLPHGGYVVHVNAVGEVAPKKLIYRDRLQTPGALQVTVGP |
| Ga0187771_114909971 | 3300018088 | Tropical Peatland | LRRGTIDRELPFGDTLPRGGYVVHVDAVGEVVPKKMIYRERMQTQGPLQVNIGP |
| Ga0210404_101815181 | 3300021088 | Soil | GTIAKELPFGETLPHGGYVVHVDAVGEVAAKNLIYREKMDTPAPLQVVVGP |
| Ga0210396_117506791 | 3300021180 | Soil | LPRGGYVVHVDAVGEVPARNIIYRERMQTPSMLQVAVGP |
| Ga0210388_104916171 | 3300021181 | Soil | MELPFGENLPHGGYIVHVDAVGEVAAKNVIYREKMDTKALQVVVGP |
| Ga0210385_104359182 | 3300021402 | Soil | PFGETLPHGGYEIHVDVVGEVAPRNLIYRDRLQTPGQLQVTVGP |
| Ga0210385_105641341 | 3300021402 | Soil | PFGETLPYGKYKVHVDAVGEVAPKNLIYREYLETPAPLEVTVGP |
| Ga0210397_102717031 | 3300021403 | Soil | ETLPHGGYVVHVDAVGEVAARNLIYRQRMETPGQLQVTVGP |
| Ga0210384_116229671 | 3300021432 | Soil | AMELPFGETLPRGGYVVHVDAVGEVAPRNLIYRERMQTPGPLQVAVGP |
| Ga0210392_102583742 | 3300021475 | Soil | PHGGYVVHVDAVGEVAPKNLIYRANMQTPSALQVTVGP |
| Ga0210402_119722712 | 3300021478 | Soil | RGGYVVHVDVIGEVAPKNVIHRQRLQTPGALQVAVGP |
| Ga0210410_106048221 | 3300021479 | Soil | GETLPHGGYVVHVDAVGEVAPRKLIYRADLKTPGPLQVTVGP |
| Ga0210409_101405631 | 3300021559 | Soil | DTLAHGGYVVHVDAVGEVGKRNLIYRERLQTPRPLQVTVGP |
| Ga0207692_109184541 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GGYVVHVDAVGEVAARNLIYRERMQTPGPLQVAVGP |
| Ga0207693_111943191 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VLRRGAVEQELPFGETLPGGGYVVHVDAVGEVAAKSLIYRDRLQTPGALQVSVGP |
| Ga0207652_105351931 | 3300025921 | Corn Rhizosphere | EQELPFGETLPRGGYVVHVDAVGEVAAKNLIYRDRLQTPGELQVSVGP |
| Ga0208532_10038642 | 3300026011 | Rice Paddy Soil | PHGGYVVHVDAVGEVSPKNLIYRDRMQTPGQLQVMVGP |
| Ga0179593_10632784 | 3300026555 | Vadose Zone Soil | MELPFGETLPRGGYVVHVDAVGEVAQRNLDLLYRERMQTAGPVAGGSPARR |
| Ga0209421_10883272 | 3300027432 | Forest Soil | PGTQAVELPFGETLPYGRYKVHLDAVGEVAPKKVIYREHLDTPGALQVTVGP |
| Ga0209735_10088041 | 3300027562 | Forest Soil | PFGETLPPGGYVVHVDAVGEVAAQKLIYRERLQTPAPLRVTVGP |
| Ga0209525_11476952 | 3300027575 | Forest Soil | LLKRGTVAMELPFGENLPHGGYIVHVDAVGEVAAKNVIYREKMDTKALQVVVGP |
| Ga0209736_11227081 | 3300027660 | Forest Soil | KELPFGETLPPGGYVVHVDTVGELAAQKLIYRERLQTPSALQVTVGP |
| Ga0209118_10582001 | 3300027674 | Forest Soil | RQGTIAKELPFGETLPHGGYVVHVDAVGEVPLKRLIYRERMVTPSALQVVVGP |
| Ga0209328_100754982 | 3300027727 | Forest Soil | VRGTVAKELPFGETLPPGGYGVHVDAVGEVASKNVIYRQRMETPSALQVVAGT |
| Ga0209517_104265362 | 3300027854 | Peatlands Soil | TIGMELPFGETLPHGGYVVHVDAVGEVAPKKLIYRDRMETPRPLQVTVGP |
| Ga0209167_102949601 | 3300027867 | Surface Soil | PRGGYVVHVDAVGEVAAKRLIYRDRMQTPSALQVTVGP |
| Ga0209006_103098741 | 3300027908 | Forest Soil | TLPRGGYVIYVDAIGEVAARNLIYREHMHTPGPLQVNVGP |
| Ga0209698_108829092 | 3300027911 | Watersheds | RGTVGQELPFGETLPRGGYVVHVDAVGEVPAKNIIYRERMQTPSMLQLPVGP |
| Ga0308309_103082431 | 3300028906 | Soil | KNGTVGMELPFGETLPHGGYVIHVDAVGEVAARNLIYRDRMQAPGPLQVTVGP |
| Ga0170824_1181241252 | 3300031231 | Forest Soil | ELPFGETLPHGGYVIHVDAVGEVAAKNLIFRDRMQTPGPLQVTVGP |
| Ga0302326_105525702 | 3300031525 | Palsa | MLTRGTVAKELPFGEILPHGGYVIHVDAVGEVAARNLIYRERLQTPGALQVTLGP |
| Ga0307474_106272441 | 3300031718 | Hardwood Forest Soil | VLAGRGTTKELPFGETLPHGGYVVHVDAVGEVAKFNKIYRQRMQTAALQVTVGP |
| Ga0307478_117001371 | 3300031823 | Hardwood Forest Soil | GETLPNGGYAVHVDAVGEVAARNLIYRDKLDTPEPLQVAVRP |
| Ga0307479_104380041 | 3300031962 | Hardwood Forest Soil | FMLRRGTIAKELPFGETLPPGGYVVHVDTVGEVAAQKLIYRERLQTPAPLRVIVGP |
| Ga0307479_108667392 | 3300031962 | Hardwood Forest Soil | PRGGYVVHVDAVGEVPARNIIYRERMQTPSMLQVAVGP |
| Ga0308176_112962072 | 3300031996 | Soil | HRGTVGKELPFGETLPHGGYVVHVDAVGEVSPKNLIYRDRMQTAGQLQVTVGP |
| Ga0318558_105695291 | 3300032044 | Soil | GTLAQELPFGETLPRGGYVVHVDAVGEVPPRNVIYRERMQTPTMLQVAVGP |
| Ga0306924_107729142 | 3300032076 | Soil | HFVLRRGTLAQELPFGETLPRGGYVVHVDAVGEVPPRNVIYRERMQTPTMLQVAVGP |
| Ga0311301_106454921 | 3300032160 | Peatlands Soil | FLLRKQTLKKELPFGDTLPRGGYVVHVDAVGEVESKKLIYRERMQTPEALQVMVGP |
| Ga0311301_111991431 | 3300032160 | Peatlands Soil | TQAVELPFGETLPYGRYKVHVDAVGEVAARKLIYREYLETPGPLQVTVGP |
| Ga0307471_1003272101 | 3300032180 | Hardwood Forest Soil | PRGRYIVHVDAVGEDLVKKKIYRARLQTHGALSVP |
| Ga0307471_1007450771 | 3300032180 | Hardwood Forest Soil | RGTVDKELPFGETLPHGGYVVHVDAVGEVAAKNIIYRERMQTPSMLQVTVGP |
| Ga0306920_1043921472 | 3300032261 | Soil | GETLPRGGYVVHVDAVGEVAARNVIYRERLQTPSMLQVAVGP |
| Ga0310812_100599322 | 3300032421 | Soil | IGYQRFVLRRGTLEQELPFGEALPRGSYVVHVDAVGEVGAKNLIYRDRLQTPGALQVSVG |
| Ga0335080_106238921 | 3300032828 | Soil | MELPFGETLPRGGYVVHVDAIGEVAARNVIHRQRLQTPAALQVAVGP |
| Ga0335076_106384522 | 3300032955 | Soil | FGDTLPQGTYVVHVDAVGEVAAKKLIYRDRLQSQSLQVMIGP |
| ⦗Top⦘ |