| Basic Information | |
|---|---|
| Family ID | F105674 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 38 residues |
| Representative Sequence | ALEAGEGLGRDMYSLTVEETLAHLEAVVTAMQAQVPA |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.01 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.15% β-sheet: 0.00% Coil/Unstructured: 73.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00821 | PEPCK_GTP | 20.00 |
| PF01293 | PEPCK_ATP | 16.00 |
| PF04226 | Transgly_assoc | 13.00 |
| PF01642 | MM_CoA_mutase | 12.00 |
| PF01871 | AMMECR1 | 2.00 |
| PF01925 | TauE | 1.00 |
| PF03544 | TonB_C | 1.00 |
| PF01479 | S4 | 1.00 |
| PF00708 | Acylphosphatase | 1.00 |
| PF04055 | Radical_SAM | 1.00 |
| PF12836 | HHH_3 | 1.00 |
| PF00082 | Peptidase_S8 | 1.00 |
| PF00156 | Pribosyltran | 1.00 |
| PF12732 | YtxH | 1.00 |
| PF00722 | Glyco_hydro_16 | 1.00 |
| PF02578 | Cu-oxidase_4 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 20.00 |
| COG1866 | Phosphoenolpyruvate carboxykinase, ATP-dependent | Energy production and conversion [C] | 16.00 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 13.00 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 12.00 |
| COG2078 | Predicted RNA modification protein, AMMECR1 domain | General function prediction only [R] | 2.00 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 1.00 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 1.00 |
| COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.00 % |
| Unclassified | root | N/A | 31.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100877588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 779 | Open in IMG/M |
| 3300003219|JGI26341J46601_10035537 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300003352|JGI26345J50200_1022152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 668 | Open in IMG/M |
| 3300004080|Ga0062385_10562247 | Not Available | 715 | Open in IMG/M |
| 3300004152|Ga0062386_101094435 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300005542|Ga0070732_10370223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 863 | Open in IMG/M |
| 3300005712|Ga0070764_10430800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300005712|Ga0070764_10509348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300005712|Ga0070764_10594957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300005764|Ga0066903_103041471 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 908 | Open in IMG/M |
| 3300005921|Ga0070766_10194284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1266 | Open in IMG/M |
| 3300005921|Ga0070766_10330391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 986 | Open in IMG/M |
| 3300005921|Ga0070766_11058343 | Not Available | 559 | Open in IMG/M |
| 3300006052|Ga0075029_100800371 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300006174|Ga0075014_100455066 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300009628|Ga0116125_1069452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300009633|Ga0116129_1251133 | Not Available | 500 | Open in IMG/M |
| 3300009634|Ga0116124_1065607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1051 | Open in IMG/M |
| 3300009639|Ga0116122_1040273 | Not Available | 1604 | Open in IMG/M |
| 3300010043|Ga0126380_11929459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300010047|Ga0126382_10312588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
| 3300010376|Ga0126381_100952514 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300010379|Ga0136449_100292368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2979 | Open in IMG/M |
| 3300010379|Ga0136449_103349052 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300010396|Ga0134126_10314819 | Not Available | 1833 | Open in IMG/M |
| 3300010397|Ga0134124_11300071 | Not Available | 750 | Open in IMG/M |
| 3300011120|Ga0150983_14553186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300012349|Ga0137387_10686703 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012683|Ga0137398_10155187 | Not Available | 1488 | Open in IMG/M |
| 3300012958|Ga0164299_10339703 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300013297|Ga0157378_11175578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300014160|Ga0181517_10157302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1271 | Open in IMG/M |
| 3300015241|Ga0137418_10596932 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300017932|Ga0187814_10402978 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300018003|Ga0187876_1018699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3341 | Open in IMG/M |
| 3300018008|Ga0187888_1200425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300018038|Ga0187855_10330787 | Not Available | 890 | Open in IMG/M |
| 3300018042|Ga0187871_10032573 | All Organisms → cellular organisms → Bacteria | 3247 | Open in IMG/M |
| 3300018047|Ga0187859_10232324 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300018085|Ga0187772_10611997 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300018090|Ga0187770_11297612 | Not Available | 590 | Open in IMG/M |
| 3300019182|Ga0184598_120348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300019877|Ga0193722_1146943 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300020581|Ga0210399_10550800 | Not Available | 956 | Open in IMG/M |
| 3300021178|Ga0210408_10899383 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300021401|Ga0210393_10932093 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300021402|Ga0210385_10083814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2194 | Open in IMG/M |
| 3300021406|Ga0210386_11140064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300021407|Ga0210383_11711183 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300021478|Ga0210402_10078774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2927 | Open in IMG/M |
| 3300021479|Ga0210410_11016858 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300023250|Ga0224544_1048142 | Not Available | 611 | Open in IMG/M |
| 3300024220|Ga0224568_1032516 | Not Available | 554 | Open in IMG/M |
| 3300025463|Ga0208193_1115762 | Not Available | 500 | Open in IMG/M |
| 3300025904|Ga0207647_10454571 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300025939|Ga0207665_10797242 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300025944|Ga0207661_10403996 | Not Available | 1239 | Open in IMG/M |
| 3300026088|Ga0207641_11785122 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300026325|Ga0209152_10225722 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300026890|Ga0207781_1010439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 992 | Open in IMG/M |
| 3300027521|Ga0209524_1090417 | Not Available | 643 | Open in IMG/M |
| 3300027587|Ga0209220_1018620 | All Organisms → cellular organisms → Bacteria | 1851 | Open in IMG/M |
| 3300027651|Ga0209217_1203669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300027812|Ga0209656_10423882 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300027829|Ga0209773_10149613 | Not Available | 972 | Open in IMG/M |
| 3300027867|Ga0209167_10147139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1234 | Open in IMG/M |
| 3300027884|Ga0209275_10787297 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300027894|Ga0209068_10090106 | Not Available | 1606 | Open in IMG/M |
| 3300028036|Ga0265355_1020437 | Not Available | 571 | Open in IMG/M |
| 3300028566|Ga0302147_10265058 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300028773|Ga0302234_10462912 | Not Available | 542 | Open in IMG/M |
| 3300028774|Ga0302208_10080898 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300028776|Ga0302303_10328912 | Not Available | 512 | Open in IMG/M |
| 3300028780|Ga0302225_10042627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2257 | Open in IMG/M |
| 3300029911|Ga0311361_10808094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300029918|Ga0302143_1082289 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300029984|Ga0311332_10684127 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300029989|Ga0311365_10661657 | Not Available | 905 | Open in IMG/M |
| 3300030053|Ga0302177_10518922 | Not Available | 614 | Open in IMG/M |
| 3300030057|Ga0302176_10182501 | Not Available | 835 | Open in IMG/M |
| 3300030503|Ga0311370_11679758 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300030746|Ga0302312_10276959 | Not Available | 634 | Open in IMG/M |
| 3300030763|Ga0265763_1052267 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031474|Ga0170818_108229977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 585 | Open in IMG/M |
| 3300031525|Ga0302326_10135294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4286 | Open in IMG/M |
| 3300031682|Ga0318560_10440018 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300031708|Ga0310686_118165292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300031718|Ga0307474_11307199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300031754|Ga0307475_11493309 | Not Available | 519 | Open in IMG/M |
| 3300031820|Ga0307473_10068562 | Not Available | 1768 | Open in IMG/M |
| 3300031820|Ga0307473_11024953 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031938|Ga0308175_103106277 | Not Available | 516 | Open in IMG/M |
| 3300032515|Ga0348332_10635742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300032782|Ga0335082_10243361 | Not Available | 1684 | Open in IMG/M |
| 3300032783|Ga0335079_10618630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1140 | Open in IMG/M |
| 3300032783|Ga0335079_11751189 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300032805|Ga0335078_10822684 | Not Available | 1129 | Open in IMG/M |
| 3300032954|Ga0335083_10872452 | Not Available | 716 | Open in IMG/M |
| 3300033158|Ga0335077_11200093 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.00% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.00% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.00% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.00% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028566 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028774 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1008775881 | 3300002245 | Forest Soil | LQAALAAGEGLGREMYSLTVEETLAHLEAVVSAMQAPVVA* |
| JGI26341J46601_100355371 | 3300003219 | Bog Forest Soil | HYLQSALQAGEGLGREMYSLTIAETLAHLEAVVSAMQEPATA* |
| JGI26345J50200_10221522 | 3300003352 | Bog Forest Soil | YLKAALRAGEGLGRDMYSLTVAETLAHLDAAVAAMQAPVTA* |
| Ga0062385_105622472 | 3300004080 | Bog Forest Soil | LQAALHAGEGLGREMYSLTVEETLAHLEAVVSAMQAPVTA* |
| Ga0062386_1010944352 | 3300004152 | Bog Forest Soil | KTAIESGEGSGREMYSLTVEETLAHLDAAVAAMQAEVPA* |
| Ga0070732_103702231 | 3300005542 | Surface Soil | LKKALESGEGVGSEMYSLTVEETLAHLEAAVAEMQEQPA* |
| Ga0070764_104308001 | 3300005712 | Soil | YLNGALQAGEGLGRDMYSLTVEQTLAHLEAAVAAMQAAVPA* |
| Ga0070764_105093483 | 3300005712 | Soil | LKTAIESGESSGREMYSLTVKETLAHLDAAVAAMQAEVTA* |
| Ga0070764_105949572 | 3300005712 | Soil | LEAGEGVGREMYSLTVDETLAHLYAAVAEMQAQPA* |
| Ga0066903_1030414712 | 3300005764 | Tropical Forest Soil | ESGEGLGREMYSLTVDETLAHLEAAVAEMEAQPA* |
| Ga0070766_101942844 | 3300005921 | Soil | TALETGEGLGREMFSLTSEETLTHLEAAVAAMQDQVPA* |
| Ga0070766_103303911 | 3300005921 | Soil | GHYLKTALQAGEGLGRDMYSLTVAETLAHLESVVAAMQSAVPA* |
| Ga0070766_110583431 | 3300005921 | Soil | ALEAGEGLGRDMYSLTTEETLAHLEAAISAMQSPVAVSR* |
| Ga0075029_1008003712 | 3300006052 | Watersheds | SGEGVGREMYSLTVEETLRHLEAVVSEGEAALATGN* |
| Ga0075014_1004550662 | 3300006174 | Watersheds | LESGEGVGREMYSLTVEETIKNLDALVSEAQVEAPAAAR* |
| Ga0068871_1011615512 | 3300006358 | Miscanthus Rhizosphere | ESGEGMDREMYSLTVDETIRHLNALVNSEIQPAIAE* |
| Ga0116125_10694521 | 3300009628 | Peatland | YLKAALEAGEGLGRDMYSLTVEETLAHLDAAVAAMQAPVTA* |
| Ga0116129_12511332 | 3300009633 | Peatland | GEGLGRDMYSLTTEETLAHLDAAISAMQSPVAVSR* |
| Ga0116124_10656073 | 3300009634 | Peatland | AAGEGLGRDMYSLTVEETLAHLEAVVTAMQAPVTV* |
| Ga0116122_10402732 | 3300009639 | Peatland | ALQAGEGLGRDMYSLTVEETLAHLEAVVSAMQAPAAV* |
| Ga0126380_119294591 | 3300010043 | Tropical Forest Soil | LESGEGVGREMYSLTVDQTLQHLEAAVKELEDAVLAVQN* |
| Ga0126382_103125881 | 3300010047 | Tropical Forest Soil | KTALESGEGVGREMYSLTVDQTLQHLEAAVKELEDAALAVQN* |
| Ga0126381_1009525141 | 3300010376 | Tropical Forest Soil | LESGEGVGREMYALTVEETLKHLEKAVAEMEAQPA* |
| Ga0136449_1002923687 | 3300010379 | Peatlands Soil | ALEAGEGLGRDMYSLTVEETLAHLEAVVTAMQAQVPA* |
| Ga0136449_1033490522 | 3300010379 | Peatlands Soil | SALESGEGVGREMYSLTIRETLQHLEGVVAEAEAATPA* |
| Ga0134126_103148191 | 3300010396 | Terrestrial Soil | ESGEGVGREMYSLTAEDTLKHLEAVAQQPEAQPVE* |
| Ga0134124_113000711 | 3300010397 | Terrestrial Soil | EGVGREMYSLSVDDTLRHLEAAVQEMEATPATASL* |
| Ga0150983_145531861 | 3300011120 | Forest Soil | LEAGEGLGRDMYSLAVEETLAHLDAVVTAMQSPVTA* |
| Ga0137387_106867032 | 3300012349 | Vadose Zone Soil | ALEAGEGVGREMYSLTVDQTLEHLEAVVADVEASALSNR* |
| Ga0137398_101551871 | 3300012683 | Vadose Zone Soil | SGEGVGREMYSLTVEETLKHLDAVVAEAGAPVTAK* |
| Ga0164299_103397032 | 3300012958 | Soil | VESGEGLGRDMYTLTVEETLKHLDDAVKEMEAQPA* |
| Ga0157378_111755781 | 3300013297 | Miscanthus Rhizosphere | ESGEGLGKEMYSLTVEQTLQNLDAVVKEPETAIV* |
| Ga0181517_101573022 | 3300014160 | Bog | LQSALQAGEGLGREMYSLTIEETLAHLEAAVSAMQEPATV* |
| Ga0137418_105969323 | 3300015241 | Vadose Zone Soil | HYLKAALEAGEGLGRDMYSLTVEETLAHLEGAVAAMQAPVSA* |
| Ga0187814_104029781 | 3300017932 | Freshwater Sediment | LEAGEGVGREMYSLTIEETLANLEAAVGEMQAQPA |
| Ga0187876_10186994 | 3300018003 | Peatland | ALQAGEGLGRDMYSLTVEETLAHLEAVVSAMQAPAAV |
| Ga0187888_12004252 | 3300018008 | Peatland | YLKTALESGGGLGREMYSLSVEETLAHLEAVVEAMQAPVPA |
| Ga0187855_103307871 | 3300018038 | Peatland | TALQSGEGLGCEMYSLTIEETLTHLDAVVSAMQEPASVSE |
| Ga0187871_100325731 | 3300018042 | Peatland | YLQTALQSGEGLGCEMYSLTIEETLTHLDAVVSAMQEPASVPE |
| Ga0187859_102323242 | 3300018047 | Peatland | VYYLWTALEAGEGLGREMYSLTTEEALAHLEAAVSAMQAPATIGQ |
| Ga0187772_106119972 | 3300018085 | Tropical Peatland | ALETGEGLGREMYGLTVEETLAHLDATVAELESAVAGAH |
| Ga0187770_112976121 | 3300018090 | Tropical Peatland | ALESGEGLGSEMYSLTVEEALAHLDAAIAEMEAQPA |
| Ga0184598_1203481 | 3300019182 | Soil | LQAGEGLGRDMYSLTVAETLAHLEAAVAAMQAPVPA |
| Ga0193722_11469431 | 3300019877 | Soil | LEAGEGVGREMYSLTIEETLAHLDAAVAEMQALPA |
| Ga0210399_105508001 | 3300020581 | Soil | KTALESGEGVGREMYSLTVEETIKNLDALVSEAQIETPATAR |
| Ga0210408_108993833 | 3300021178 | Soil | KTALQSGEAVGSEMYSLTVEQTLSHLEAAVAEMQAEAAV |
| Ga0210393_109320931 | 3300021401 | Soil | QAALAAGEGLEREMYSLTVEETLAHLEAVVSAMQAAVIA |
| Ga0210385_100838146 | 3300021402 | Soil | LKSALEAGEGMGREMYALTVEETLAHLEAAVAAMQAPVPA |
| Ga0210386_111400641 | 3300021406 | Soil | LHAGEGLGRDMYSLTVAETLAHLESVVAAMQSAVPA |
| Ga0210383_117111832 | 3300021407 | Soil | LEAGEGLGREMYSLPVEETLAHLDSAVAAMQASVPA |
| Ga0210402_100787741 | 3300021478 | Soil | ALESGEGVGREMYSLTVEETLKHLEAVVHQPEVQPVT |
| Ga0210410_110168581 | 3300021479 | Soil | LKTALESGEGVGREMYSLTVEETLKHLEAVVHQPEVQPVT |
| Ga0224544_10481421 | 3300023250 | Soil | YLQAALAAGEGLGRDMYSLTVEETLAHLEAAVTAMQAPATA |
| Ga0224568_10325161 | 3300024220 | Plant Litter | LAAGEGLGREMYSLTVEETLAHLEAVVTVMQAAVTA |
| Ga0208193_11157621 | 3300025463 | Peatland | GEGLGRDMYSLTTEETLAHLDAAISAMQSPVAVSR |
| Ga0207647_104545712 | 3300025904 | Corn Rhizosphere | GEGVGREMYSLSVDDTLRHLEAAVQEMEATPATASL |
| Ga0207665_107972421 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KTALEAGEGLGREMYSLTVEETLAHLDAAVAEMEGQPA |
| Ga0207661_104039961 | 3300025944 | Corn Rhizosphere | KHALESGEGVGREMYSLSVDDTLRHLEAAVQEMEATPATASS |
| Ga0207641_117851222 | 3300026088 | Switchgrass Rhizosphere | GEGVGREMYSLSVDDTLRHLEAAVQEMEATPATASS |
| Ga0209152_102257222 | 3300026325 | Soil | EGVGREMYSLSVDDTLRHLEAAVQEMEATPATASS |
| Ga0207781_10104391 | 3300026890 | Tropical Forest Soil | LESGEGLGREMYSLTVEETLVHLDAAVAEMQAQPA |
| Ga0209524_10904172 | 3300027521 | Forest Soil | ALEAGEGLGREMYSLTIAETLTHLEAAVAEMQAQPA |
| Ga0209220_10186204 | 3300027587 | Forest Soil | KTALESGEAVGSEMYSLTIEQTLSHLDAAVAEMQAEAAV |
| Ga0209217_12036692 | 3300027651 | Forest Soil | LKTALESGEAVGSEMYSLTIEQTLSHLDAAVAEMQAEAAV |
| Ga0209656_104238822 | 3300027812 | Bog Forest Soil | ALEAGEGVGREMYSLTVEETLAHLDAVVAEMQAQLA |
| Ga0209773_101496131 | 3300027829 | Bog Forest Soil | ESGEGSGREMYSLTVEETLAHLDAAVSAMQAEVTA |
| Ga0209167_101471393 | 3300027867 | Surface Soil | ALQGGEGLGREMYSLTVEETLSHLEGVVAEMQTTAMA |
| Ga0209275_107872971 | 3300027884 | Soil | EAGEGLGREMYSLTVVETLAHLEAVVNAMQTASPA |
| Ga0209068_100901061 | 3300027894 | Watersheds | SGEGAGREMYSLTVEETLKHLDGVVTQLEENIVVPR |
| Ga0265355_10204371 | 3300028036 | Rhizosphere | ESGESSGREMYSLTVAETLAHLDAAVAAMQAEVTA |
| Ga0302147_102650582 | 3300028566 | Bog | LKSALEAGEGLGREMYSLTVEETLEHIDAVVAAMQSPVPA |
| Ga0302234_104629122 | 3300028773 | Palsa | GHYLQAALQAGEGLGRDMYSLTIEETLAHLEAVVTAMQAPVTA |
| Ga0302208_100808982 | 3300028774 | Fen | ESGEGLGREMYSLTVEETLRHLDAIAADLQSPAVVAR |
| Ga0302303_103289121 | 3300028776 | Palsa | TAIESGDGSGREMYSLTVPETLAHLDAAVSAMQAEVTA |
| Ga0302225_100426275 | 3300028780 | Palsa | GHYLKTALETGEGLGREMFSLTSDETLAHLDAAVAAMQAQVPA |
| Ga0311361_108080942 | 3300029911 | Bog | TALESGGGLGREMYSLSVEETLAHLEAVVEAMQAPVPA |
| Ga0302143_10822891 | 3300029918 | Bog | GLGREMYSLTTEETLAHLDAVVAAMQAAIPQAATV |
| Ga0311332_106841271 | 3300029984 | Fen | GLESGEGVGKEMYSLTIDETLKHLDAVVTESGSRA |
| Ga0311365_106616571 | 3300029989 | Fen | ESGEGVGREMYTLSVEEALRQLEGVVADSEGLKVPQA |
| Ga0302177_105189221 | 3300030053 | Palsa | LQAALAAGEGLGRDMYSLTVEETLAHLEAAVTAMQAPATA |
| Ga0302176_101825012 | 3300030057 | Palsa | LAAGEGLGRDMYSLTVEETLAHLEAAVTAMQAPATA |
| Ga0311370_116797582 | 3300030503 | Palsa | KAALQAGEGLGRDMYSLTVEETLAHLEAVVVAMQAQVPA |
| Ga0302312_102769591 | 3300030746 | Palsa | QAGEGLGRDMYSLTIEETLAHLEAVVTAMQAPVTA |
| Ga0265763_10522671 | 3300030763 | Soil | LEAGEGLGCEMYSLTVAETLSHLEAAVAAMQAPALA |
| Ga0170818_1082299773 | 3300031474 | Forest Soil | LEAGEGLGREMYSLTIEETLAHLEAAVAEMQAQPA |
| Ga0302326_101352941 | 3300031525 | Palsa | KAALQAGEGLGRDMYSLTVEETLAHLEAVVTAMQAQVPA |
| Ga0318560_104400181 | 3300031682 | Soil | LKTALESGEGVGREMYSLTVEETIKNLDALVSEAQVEAPAATPAPTR |
| Ga0310686_1181652922 | 3300031708 | Soil | LQAGEGLGRDMYSLTVEETLAHLEAVVAAMQSTVPA |
| Ga0307474_113071991 | 3300031718 | Hardwood Forest Soil | TALQAGEGLGRDMYSLTVAETLAHLESVVAAMQSAVPA |
| Ga0307475_114933092 | 3300031754 | Hardwood Forest Soil | QSGEGAGRELYSLTVEETLAHLSAAVADMQAKATA |
| Ga0307473_100685622 | 3300031820 | Hardwood Forest Soil | KTALESGEGIDREMYSLTVNQTLHHLNAIVAELQSAQPVGPE |
| Ga0307473_110249531 | 3300031820 | Hardwood Forest Soil | TALESGEGLGREMYSLTVEETLAHLDAAVAEMEAQPA |
| Ga0308175_1031062771 | 3300031938 | Soil | EGVGREMYSLTVPEMFTHLEAVVSESEQQPAEAEQPA |
| Ga0348332_106357422 | 3300032515 | Plant Litter | LKAALQAGEGLGRDMYSLTVEETLAHMEAVVAAMQSTVPA |
| Ga0335082_102433612 | 3300032782 | Soil | LKTALESGEGVGREMYSLTVAETLAHLDAAVAEMQAEVTA |
| Ga0335079_106186301 | 3300032783 | Soil | KTALESGEGVGREMYSLSVAETLKHLDAVVNETSMVVAD |
| Ga0335079_117511892 | 3300032783 | Soil | KSALEAGEGVGREMYSLTVDEALRHLEAVKSEAEAAAEATR |
| Ga0335078_108226842 | 3300032805 | Soil | ETGEGLGREMYGLTVEETLDHLDAIAAEIETPAAVVR |
| Ga0335083_108724522 | 3300032954 | Soil | LKSALEAGEGLGREMYSLTVEETLKHLDAAVAEMEAAQPA |
| Ga0335077_112000931 | 3300033158 | Soil | LESGEGVGREMYSLTVEETLKHLEAAVTEMEAQPA |
| ⦗Top⦘ |