| Basic Information | |
|---|---|
| Family ID | F105672 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MFAGRLTQATLRALDWLAAKTLSPEDGPAHQRTGRRGEEDAY |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00892 | EamA | 37.00 |
| PF00202 | Aminotran_3 | 5.00 |
| PF03473 | MOSC | 4.00 |
| PF07927 | HicA_toxin | 4.00 |
| PF05163 | DinB | 3.00 |
| PF12867 | DinB_2 | 3.00 |
| PF14522 | Cytochrome_C7 | 2.00 |
| PF01895 | PhoU | 2.00 |
| PF02518 | HATPase_c | 2.00 |
| PF01592 | NifU_N | 1.00 |
| PF01433 | Peptidase_M1 | 1.00 |
| PF07690 | MFS_1 | 1.00 |
| PF08241 | Methyltransf_11 | 1.00 |
| PF05534 | HicB | 1.00 |
| PF08206 | OB_RNB | 1.00 |
| PF07676 | PD40 | 1.00 |
| PF14317 | YcxB | 1.00 |
| PF01694 | Rhomboid | 1.00 |
| PF09586 | YfhO | 1.00 |
| PF06480 | FtsH_ext | 1.00 |
| PF03449 | GreA_GreB_N | 1.00 |
| PF08238 | Sel1 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 4.00 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.00 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 1.00 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG0557 | Exoribonuclease R | Transcription [K] | 1.00 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 1.00 |
| COG0822 | Fe-S cluster assembly scaffold protein IscU, NifU family | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG1158 | Transcription termination factor Rho | Transcription [K] | 1.00 |
| COG1278 | Cold shock protein, CspA family | Transcription [K] | 1.00 |
| COG1598 | Antitoxin component HicB of the HicAB toxin-antitoxin system | Defense mechanisms [V] | 1.00 |
| COG4226 | Predicted nuclease of the RNAse H fold, HicB family | General function prediction only [R] | 1.00 |
| COG4776 | Exoribonuclease II | Transcription [K] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.00 % |
| All Organisms | root | All Organisms | 1.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300022557|Ga0212123_10000972 | All Organisms → cellular organisms → Bacteria | 84833 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 9.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.00% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.00% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.00% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.00% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.00% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001100 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300028674 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12703J13194_1067622 | 3300001100 | Forest Soil | MLAGRFTQVTLHVLDWLAAKMLRPEDIPARHRTGRR |
| JGI12635J15846_102016962 | 3300001593 | Forest Soil | MSGGRITQVTLRALDWLAATVLSPEDIPAHQRTGRRGEEDAYF |
| JGI25384J37096_100286541 | 3300002561 | Grasslands Soil | MSSGRLTHATIRALDWLSGKTLPGSTGPAHQRIGRHGEEDAYFF |
| JGI25389J43894_10507182 | 3300002916 | Grasslands Soil | MSSGRLTHATMRALDWLSGKTLPGSTGPAHQRIGRHGEEDAYFF |
| JGIcombinedJ51221_104117712 | 3300003505 | Forest Soil | MFAARLTQATLRALDWLTRRTLPPEDLPEHQLTGRHGEED |
| Ga0062386_1004367413 | 3300004152 | Bog Forest Soil | MSSGRLTHATVRAIDWLAVHTLPAEKTPEHQRTGRRGEEDAYFFLRRRGY |
| Ga0062388_1026376073 | 3300004635 | Bog Forest Soil | MFAGRLTQATLRALDWLAAKTLSPEDGPAHQRTGRRGEEDAY |
| Ga0066677_108344512 | 3300005171 | Soil | MSSGRLTHATMRALDWLSGKTLPGSTGPAHQRIGRHGEEDAYFFLRKLGYV |
| Ga0070708_1003133124 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VLTGRLTHATIRALDWLAHRTLPADKKDKHPEHQRTGRRGEEDAYFHLRKLG |
| Ga0066689_108686791 | 3300005447 | Soil | MSSGRLTHATIRALDWLSGKTLPGSTGPAHQRIGRHGEEDAYFFLRKLGYV |
| Ga0070707_1010977163 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MFSGRLTHATIRALDWLAGKTLPRSTGPAHQGIGRHGEEDAY |
| Ga0070707_1016769101 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAGRLTQATLRALDWLAGHTLPPDDLPAHQRTGRRGEEAAYFYL |
| Ga0070699_1005199744 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSGRLTHATIRALDWLSGKTLPGSIGPAHQRIGRHGEEDAYFHLRKLGY |
| Ga0066692_103842822 | 3300005555 | Soil | MFAGRLTQATLRALDWLAARTLSPDDTPAHLRIGRR |
| Ga0066699_112194051 | 3300005561 | Soil | MFAGRLTQATLRALDWLAARTLSPEDVPTHQRTGRRGEEDAYFYL |
| Ga0066795_101772952 | 3300005938 | Soil | MFAGRLTQVTLRALDWLAAKTLSPEDTPAHQRTGRR |
| Ga0075029_1002766831 | 3300006052 | Watersheds | MFAGRLTQATVYVLDWLADRTLPPEEMPAHQRTGRRGEEDAYFYLRRRG |
| Ga0075014_1005458881 | 3300006174 | Watersheds | MLAGRLTQATLRALDWLAAITLPPDDSPAHQLIGRLGEEHAYF |
| Ga0070712_1011449271 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAGRFTQVTLRALDWFAARMLSPEDIPAHQRTGRRG |
| Ga0073928_1000797211 | 3300006893 | Iron-Sulfur Acid Spring | MFAGRLTQATICALDWLAARTLSPEDMPAHPRTGRRGEGDAYCYLRRRGYTIIARN* |
| Ga0116222_12542902 | 3300009521 | Peatlands Soil | MSSGRLTHATIHAFDWLAERTLPPEKIPPHQRTGRRGEEAAYFHLRKNGYVM |
| Ga0116133_10236554 | 3300009623 | Peatland | MEPSMFAGRLTQATLHILDWLAAKMLSPEEMPVHQR |
| Ga0116119_11113931 | 3300009629 | Peatland | MFAGRLTQVTLRALDWLAAITLPPEDLPAHQRTGRRGEEDAYFY |
| Ga0116118_10777683 | 3300009637 | Peatland | MFAGRLTQATIRALDWLAARTLAEEDLPAHQRTGRRGEE |
| Ga0116121_12051881 | 3300009644 | Peatland | MGFSMFAGRLTQATVHALDWLAARTLAEEDLPAHQRTGRRGEEDAYFYLS |
| Ga0116216_107357311 | 3300009698 | Peatlands Soil | MGFSMFAGRLAQATVRALDWLAARTLAAEDLPAHQRTGRRGEEDA |
| Ga0116131_12245171 | 3300009760 | Peatland | MFAGRLTAGTLRALDWLAARTLPPEDLPAHHLTGRRGEEDAYFYLR |
| Ga0116223_103056251 | 3300009839 | Peatlands Soil | MFSGRLTQATLRALDWLTERTLSPEDIPANQRTGRRGEEDAYFYLRGNILRRKRS |
| Ga0116223_107999161 | 3300009839 | Peatlands Soil | MLTGFSGRVTQAAVRALDWVAERTLAPEDIPRHQRTGRRGEEDAYFYLRR |
| Ga0116223_108417432 | 3300009839 | Peatlands Soil | MGFLMFAGRLTQATLRALDWLAARTLSAEDLPAHQLTGPRGEE |
| Ga0127489_11622061 | 3300010127 | Grasslands Soil | MLSGRLTHATIRALDWLAGKTLPGSTGPAHQRIGRHGEEDAYFHL |
| Ga0074045_109086071 | 3300010341 | Bog Forest Soil | MPNIFSGRLTQAAVRALDWVAERTLPAEDIPMHQRT |
| Ga0134126_110167871 | 3300010396 | Terrestrial Soil | MPSGRLTHAAIRTLDWLAAKTLSPENIPPHQRTGRAGEEAAYFYLR |
| Ga0126383_1000006635 | 3300010398 | Tropical Forest Soil | MLPGSLVQATLRALDWVADRTLLPSNLPEHHRTGRQGEEDAYFYLR* |
| Ga0137393_102256373 | 3300011271 | Vadose Zone Soil | MSGRFTHATIRLLDWLTEMTLPATAVPEHQVTGRRGEEGAYFYLRKRG* |
| Ga0137377_106420761 | 3300012211 | Vadose Zone Soil | MEFSMFAGRLTQATLRALDWLAARTLSPEDMPAHQRTGRRGEEDA |
| Ga0137390_107364861 | 3300012363 | Vadose Zone Soil | MFAGRLTQATLRALDWLAARTLSPEDTPAHQRTGRR |
| Ga0137397_112533831 | 3300012685 | Vadose Zone Soil | MFAGRLTQATVRALDWLATKTLSAEDIPAHHVIGRRGEEDAYFYL |
| Ga0137396_111938152 | 3300012918 | Vadose Zone Soil | MLAGRFTHATIRALDWLAERTLPAEKIPDRHRTGRRGEEDAYFHLRKLG |
| Ga0137394_109090921 | 3300012922 | Vadose Zone Soil | MFAGRLTQATLRALDWLAGRTLPPDDLPPHQRTGRRGEE |
| Ga0137413_105581231 | 3300012924 | Vadose Zone Soil | MFSGRVTQATLRALDWLAAHTVAPENLPPHQLTGRRGEEA |
| Ga0137419_105306571 | 3300012925 | Vadose Zone Soil | MFAGHLTQVTLRALDWLAARTLAPEDLPAHQRTGRRGEEDA |
| Ga0137416_110160691 | 3300012927 | Vadose Zone Soil | MFAGRLTQVTLRALDWLAARTLTAEDMPAHQRTGRRG |
| Ga0134076_100165411 | 3300012976 | Grasslands Soil | MLSGRLTHATIRALDWLAGKTLPGSTGPAHQRIGHHGEEDAYFHLRKLGYVM |
| Ga0181530_101140491 | 3300014159 | Bog | MGFSMFAGRLTQATIRALDWLAARTLSAEDLPAHQRTGRRGEEDAY |
| Ga0182018_101017491 | 3300014489 | Palsa | LSSGRLTHAAIRALDWISARVLPPEKIPAHQLTGRRGEEA |
| Ga0182011_107619812 | 3300014496 | Fen | MGFSMFAGRLTQVTLRTLDWLAARTLPPEDIPAHQRTGRRGRILGYRPGC |
| Ga0137409_101292013 | 3300015245 | Vadose Zone Soil | MSGGRVTQTTLRALDWLARHTLQAENVPPHQLTGRRGEEDAYFFLRRKGYVIIAR |
| Ga0137409_104885971 | 3300015245 | Vadose Zone Soil | MFAGRLTQVTVRALDWLASHTLPPEAGPPHQRTGRRGE |
| Ga0187818_100771141 | 3300017823 | Freshwater Sediment | MLAGRLTQATLHALDWVSDRTLPRERTPAHQRTGRRGEEDAY |
| Ga0187853_102629981 | 3300017940 | Peatland | MGLYMFAGRLTHAALRALDWLAAKTLSPEDTPAHQRTGRRGEEDAYFYL |
| Ga0187808_104906222 | 3300017942 | Freshwater Sediment | MSSGRFTHAAIRALDWLAGRTLPRDTRPEHQRVGKRGEEDAYFYLR |
| Ga0187779_109281341 | 3300017959 | Tropical Peatland | MFAGRLTHATLRVLDWLAARTLAPEDAPPHQLTGRRG |
| Ga0187782_102718851 | 3300017975 | Tropical Peatland | MSSGRLTHAAVRALDWLAEHTLPPDHRPEHQRTGRRGEDDA |
| Ga0187878_13625661 | 3300018005 | Peatland | MFTGRLTQATLRALDWLAAKTLSPEDMPAHQRTGRRGEE |
| Ga0187804_102423972 | 3300018006 | Freshwater Sediment | MFAGSLTQATLRALDWLSEKALPPDKTAEHLRTGRRGEEDAYFYL |
| Ga0187804_104755361 | 3300018006 | Freshwater Sediment | MFAGRLTQATVRAFDWVANRTLPPEEMPAHQRTGR |
| Ga0187884_103400502 | 3300018009 | Peatland | MFAGRLTQATLRALDWLAAKTLPAEDIPAHQRTGRRG |
| Ga0187873_13781691 | 3300018013 | Peatland | MFAGRLTQATLRALDWLAAKTLPAEDIPAHQRTGRRGEEDAYF |
| Ga0187864_104837811 | 3300018022 | Peatland | MFAGRLTQATLRALDWLAGKTLSPEDTPAHLRTGRRGE |
| Ga0187883_101439641 | 3300018037 | Peatland | MFVGRLTQATLRALDWLAVKTLSPEDIPAHQLTGR |
| Ga0187890_104592202 | 3300018044 | Peatland | MFAGRLTQATLRALDWLAARTLPPENMPAHQRTGRRGEEDAYFYL |
| Ga0187858_106610421 | 3300018057 | Peatland | MFAGRLTQATIRALDWLAARTLSAEDLPAHQRTGRRGEEDAYF |
| Ga0187771_100571863 | 3300018088 | Tropical Peatland | MSSGRITHAAIRALDWLAEHTLPPANLPMHQRIGRRGEDDAYFYLR |
| Ga0210399_113177571 | 3300020581 | Soil | VSSGRLTHAAVRALDWLGERTLPQREGPAHQRTGRRGEEDAYFHLR |
| Ga0210397_109985051 | 3300021403 | Soil | MLSGFSGRVTQIAVRALDWVAERTLGPEGVPAHQKTGRRG |
| Ga0210384_108711332 | 3300021432 | Soil | MFSGRLTHATIRALDWLAQLTLKDSKAPAHLQTGRKGEEDTYFFLR |
| Ga0210390_100359381 | 3300021474 | Soil | MSITFPGRFTQAAVRALDWVAERTLPAEDIPAHQRTGRRGEEAAYFY |
| Ga0210398_113367691 | 3300021477 | Soil | MSITFSGRFTQAAVRALDWVAERTLPAEDIPAHQRTGRRGE |
| Ga0212123_1000097246 | 3300022557 | Iron-Sulfur Acid Spring | MFAGRLTQATICALDWLAARTLSPEDMPAHPRTGRRGEGDAYCYLRRRGYTIIARN |
| Ga0224557_12637052 | 3300023101 | Soil | MFAGRLTQATLRALDWLAARTLSPEEMPAHQRTGRRGE |
| Ga0208455_10558882 | 3300025453 | Peatland | MGFSMFAGRLTQATVHALDWLAARTLAEEDLPAHQRTGRRGEEDAYFYLSPAGL |
| Ga0208937_10155971 | 3300025506 | Peatland | MGFPMFAGRLTQATIRALDWLAARTLAAEDLPAHQLTGRRGEEDA |
| Ga0208188_10263531 | 3300025507 | Peatland | MGFPMFAGRLTQATIRALDWLAARTLPAEDLPAHQRTGRRGEEDAYFYL |
| Ga0208188_10988042 | 3300025507 | Peatland | MFAGRLTQATIRALDWLAARTLAAEDLPAHQLTGRRGEEDAYFYLR |
| Ga0207693_114470432 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VFTGRLTQVTVRALEWLDAHLLRPEDLPAHQRTGRRGEEYAY |
| Ga0209153_12469042 | 3300026312 | Soil | MSSGRLTHATIRALDWLSGKTLPGSTGPAHQRIGRHGEEDAYFFLRKLGY |
| Ga0209376_12543031 | 3300026540 | Soil | MSSGRLTHATIRALDWLSGKTLPGSTGPAHQRIGRHGEEDAYFFLRKLGYVMV |
| Ga0179587_102849652 | 3300026557 | Vadose Zone Soil | MFAGRLTQATLRALDWLTARTLSPEDIPAHQRTGRRGEEDAY |
| Ga0208043_11217703 | 3300027570 | Peatlands Soil | MGFSMFAGRLTQATLRALDWLSARTLSPEDSPAHQRTGRRGEEDAYFY |
| Ga0209221_11774172 | 3300027609 | Forest Soil | MFSASSLSGFSGRITQATVRALDWIAERTLPAENIPAHQRTGRRGEEAAYFYLRR |
| Ga0209420_11681942 | 3300027648 | Forest Soil | VLSGRTTQASLRALDWLAALILQPDKSPPHQLTGRRGEIDL |
| Ga0209333_10916381 | 3300027676 | Forest Soil | MFAGRLTQATLRVLDWLAQRTLPPEDLPEHQRTGRRGEEDAYFYLR |
| Ga0209040_102096912 | 3300027824 | Bog Forest Soil | MSSGRLTHATVRAIDWLAVHTLPAEKTPEHQRTGRR |
| Ga0209180_104920591 | 3300027846 | Vadose Zone Soil | MSSGRLTHATMRALDWLSGKTLPGSTGPAHQRIGRHGEEDAYF |
| Ga0209517_105691171 | 3300027854 | Peatlands Soil | MLSGRLTHATIRALDWLAARTLPSEKGPAHQQTGRRGERDAYFYL |
| Ga0302161_100248081 | 3300028674 | Fen | MGVVCSMFPGRLTQATLRGFDWLSNRLLPPDDRPEHQRTGRRGEEDAYFYLRRR |
| Ga0247275_11298331 | 3300029817 | Soil | MGLYMFAGRLTHAALRALDWLAAKTLSPEDTPAHQRTG |
| Ga0311333_120208261 | 3300030114 | Fen | MFGGRITQVTLRALDWLAARSLPPENMPAHQRTGRRGEEEAY |
| Ga0302183_102716392 | 3300030509 | Palsa | MFAGRLTQAALRALDWLASRTLSPEDLPAHRITGRRGEE |
| Ga0302275_101682573 | 3300030518 | Bog | MFAGRLTQTAIRALNWLAAKTLSPEDLPPHQLTGRRGEE |
| Ga0265762_11039961 | 3300030760 | Soil | MLAGRLTQATLHVLDWFAAKLLPPEDIPAHQRTGRRGE |
| Ga0073998_116083202 | 3300031023 | Soil | MFAGPLTQATIRALDWLAARTLSPEVMPAHQRTGRRGEGDAYFYLRRLKNLTLNKN |
| Ga0265325_101636072 | 3300031241 | Rhizosphere | MFAGRLTQFTVRVLDWLLSARNVQSPDTPEHLRTGQRGEEDAYFYLRR |
| Ga0335085_118163071 | 3300032770 | Soil | MLSGRFTHATIRALDWLAARLLPPSNLPLHQRIGKRGE |
| Ga0335078_117837551 | 3300032805 | Soil | MLSGRLTHATVRALDWLAGHMLPADNRPEHQRTGKRGEEDAYFFFRRRGYVMVG |
| Ga0335076_114772842 | 3300032955 | Soil | MRSGALTQATLRCLDWLAAKTLNPDASPGHQRTGRRGE |
| Ga0335084_120297491 | 3300033004 | Soil | MLSGRFTHATIRALDWLAARLLPPSNLPLHQRIGKRGEEDAHFYLRRCGYV |
| Ga0326728_111059611 | 3300033402 | Peat Soil | MFAGRLTQATLRALDWLAARTLAPEDMPAHQRTGRRGEEDA |
| Ga0314865_219366_2_142 | 3300033806 | Peatland | MFSGHLTQAVLRALDWIAAKTLPPEEAAEHLQTGRRGEEDAYFYLRR |
| ⦗Top⦘ |