| Basic Information | |
|---|---|
| Family ID | F105641 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MTDTTPTTENRTLPRRLPNSAYRVREYLTEKEVDRLIEAAR |
| Number of Associated Samples | 64 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 97.00 % |
| Associated GOLD sequencing projects | 54 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (41.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 0.00% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00816 | Histone_HNS | 3.00 |
| PF12697 | Abhydrolase_6 | 1.00 |
| PF00149 | Metallophos | 1.00 |
| PF00884 | Sulfatase | 1.00 |
| PF09926 | DUF2158 | 1.00 |
| PF13542 | HTH_Tnp_ISL3 | 1.00 |
| PF00656 | Peptidase_C14 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG2916 | DNA-binding protein H-NS | Transcription [K] | 3.00 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.00 % |
| Unclassified | root | N/A | 48.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_101256417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1567 | Open in IMG/M |
| 3300005332|Ga0066388_106755228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Gallionella → Gallionella capsiferriformans | 578 | Open in IMG/M |
| 3300005332|Ga0066388_107512548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 547 | Open in IMG/M |
| 3300005538|Ga0070731_11154717 | Not Available | 511 | Open in IMG/M |
| 3300005764|Ga0066903_105038266 | Not Available | 700 | Open in IMG/M |
| 3300005764|Ga0066903_105160637 | Not Available | 691 | Open in IMG/M |
| 3300005764|Ga0066903_108340883 | Not Available | 529 | Open in IMG/M |
| 3300006175|Ga0070712_100342590 | Not Available | 1221 | Open in IMG/M |
| 3300009090|Ga0099827_11389688 | Not Available | 611 | Open in IMG/M |
| 3300009792|Ga0126374_10823090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 712 | Open in IMG/M |
| 3300009792|Ga0126374_11311271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300010359|Ga0126376_11549258 | Not Available | 693 | Open in IMG/M |
| 3300010360|Ga0126372_12226333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 597 | Open in IMG/M |
| 3300010360|Ga0126372_12580176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300010379|Ga0136449_100535232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2020 | Open in IMG/M |
| 3300010398|Ga0126383_11551063 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300012210|Ga0137378_10341237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1392 | Open in IMG/M |
| 3300012948|Ga0126375_10223671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1254 | Open in IMG/M |
| 3300012958|Ga0164299_10446674 | Not Available | 845 | Open in IMG/M |
| 3300012961|Ga0164302_10748600 | Not Available | 731 | Open in IMG/M |
| 3300012971|Ga0126369_10185428 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
| 3300016270|Ga0182036_11173016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
| 3300016294|Ga0182041_10143025 | Not Available | 1834 | Open in IMG/M |
| 3300016319|Ga0182033_10265272 | Not Available | 1402 | Open in IMG/M |
| 3300016319|Ga0182033_10458527 | Not Available | 1088 | Open in IMG/M |
| 3300016319|Ga0182033_10763661 | Not Available | 850 | Open in IMG/M |
| 3300016319|Ga0182033_11391636 | Not Available | 632 | Open in IMG/M |
| 3300016341|Ga0182035_10494955 | Not Available | 1043 | Open in IMG/M |
| 3300016341|Ga0182035_10809273 | Not Available | 822 | Open in IMG/M |
| 3300016341|Ga0182035_11415189 | Not Available | 624 | Open in IMG/M |
| 3300016357|Ga0182032_11206430 | Not Available | 651 | Open in IMG/M |
| 3300016371|Ga0182034_10319785 | Not Available | 1250 | Open in IMG/M |
| 3300016371|Ga0182034_11289648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300016371|Ga0182034_11393787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300016387|Ga0182040_10218305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1413 | Open in IMG/M |
| 3300016387|Ga0182040_11601497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300016404|Ga0182037_10838075 | Not Available | 795 | Open in IMG/M |
| 3300016404|Ga0182037_11179216 | Not Available | 672 | Open in IMG/M |
| 3300016404|Ga0182037_12101021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300016422|Ga0182039_10295137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1340 | Open in IMG/M |
| 3300016422|Ga0182039_10584082 | Not Available | 975 | Open in IMG/M |
| 3300016422|Ga0182039_10634980 | Not Available | 936 | Open in IMG/M |
| 3300016422|Ga0182039_11516356 | Not Available | 611 | Open in IMG/M |
| 3300016445|Ga0182038_10764965 | Not Available | 845 | Open in IMG/M |
| 3300016445|Ga0182038_11738305 | Not Available | 562 | Open in IMG/M |
| 3300017822|Ga0187802_10379598 | Not Available | 558 | Open in IMG/M |
| 3300017932|Ga0187814_10434447 | Not Available | 514 | Open in IMG/M |
| 3300017961|Ga0187778_11168895 | Not Available | 538 | Open in IMG/M |
| 3300018058|Ga0187766_11419504 | Not Available | 510 | Open in IMG/M |
| 3300021478|Ga0210402_10042029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3976 | Open in IMG/M |
| 3300021560|Ga0126371_13274804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300027915|Ga0209069_10706875 | Not Available | 592 | Open in IMG/M |
| 3300031231|Ga0170824_128874386 | Not Available | 533 | Open in IMG/M |
| 3300031469|Ga0170819_11190021 | Not Available | 596 | Open in IMG/M |
| 3300031564|Ga0318573_10519356 | Not Available | 641 | Open in IMG/M |
| 3300031573|Ga0310915_10250243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1247 | Open in IMG/M |
| 3300031573|Ga0310915_10378893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1004 | Open in IMG/M |
| 3300031573|Ga0310915_10593728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
| 3300031573|Ga0310915_10756983 | Not Available | 684 | Open in IMG/M |
| 3300031668|Ga0318542_10308827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300031719|Ga0306917_10942175 | Not Available | 675 | Open in IMG/M |
| 3300031720|Ga0307469_12203903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300031744|Ga0306918_10577274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 881 | Open in IMG/M |
| 3300031744|Ga0306918_11243033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300031770|Ga0318521_10461378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300031770|Ga0318521_10997177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300031771|Ga0318546_10546071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 814 | Open in IMG/M |
| 3300031781|Ga0318547_10218302 | Not Available | 1143 | Open in IMG/M |
| 3300031805|Ga0318497_10748170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300031833|Ga0310917_10580862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300031833|Ga0310917_10601907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 746 | Open in IMG/M |
| 3300031833|Ga0310917_10683834 | Not Available | 695 | Open in IMG/M |
| 3300031879|Ga0306919_10686722 | Not Available | 789 | Open in IMG/M |
| 3300031890|Ga0306925_10235685 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300031890|Ga0306925_10356105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1571 | Open in IMG/M |
| 3300031890|Ga0306925_10583410 | Not Available | 1182 | Open in IMG/M |
| 3300031890|Ga0306925_11304260 | Not Available | 721 | Open in IMG/M |
| 3300031910|Ga0306923_11006104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 905 | Open in IMG/M |
| 3300031912|Ga0306921_10357425 | Not Available | 1707 | Open in IMG/M |
| 3300031941|Ga0310912_10775573 | Not Available | 741 | Open in IMG/M |
| 3300031941|Ga0310912_11186117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300031942|Ga0310916_11712517 | Not Available | 508 | Open in IMG/M |
| 3300031946|Ga0310910_10903475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300031946|Ga0310910_10998572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 654 | Open in IMG/M |
| 3300031946|Ga0310910_11408685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300031947|Ga0310909_11051302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300031954|Ga0306926_10352058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1820 | Open in IMG/M |
| 3300031954|Ga0306926_12387146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 583 | Open in IMG/M |
| 3300032001|Ga0306922_10234689 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
| 3300032001|Ga0306922_10503235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1291 | Open in IMG/M |
| 3300032041|Ga0318549_10391348 | Not Available | 626 | Open in IMG/M |
| 3300032044|Ga0318558_10204606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 964 | Open in IMG/M |
| 3300032059|Ga0318533_10127118 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300032059|Ga0318533_10631841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300032063|Ga0318504_10549501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300032076|Ga0306924_10379994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1618 | Open in IMG/M |
| 3300032261|Ga0306920_100057881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 5648 | Open in IMG/M |
| 3300032261|Ga0306920_104284784 | Not Available | 513 | Open in IMG/M |
| 3300032828|Ga0335080_11742055 | Not Available | 610 | Open in IMG/M |
| 3300033290|Ga0318519_10660280 | Not Available | 638 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 41.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1012564171 | 3300000955 | Soil | MTDTASTTVNRTLQRLPNSAYRPREYLTEKEVDRLIEAARK |
| Ga0066388_1067552281 | 3300005332 | Tropical Forest Soil | MTDTSSTTVNRTLRRLPNSAYRVREYLTEKEVDRLIEAARKRGRN |
| Ga0066388_1075125481 | 3300005332 | Tropical Forest Soil | MTEAAPSAANRTLRRLPNSAYRPREYLTEAEVDRLIEAARKR |
| Ga0070731_111547171 | 3300005538 | Surface Soil | MTEATPTTANRTLRRLPNATYRPREYLTEAEVTRLIE |
| Ga0066903_1050382663 | 3300005764 | Tropical Forest Soil | MSDVTPSAANRTLRRLPNAAYRPREYLTEAEVERL |
| Ga0066903_1051606371 | 3300005764 | Tropical Forest Soil | MTSGAPTTVKRTLGRLPNTAYRPREYLTEQGVEKLIEAARK |
| Ga0066903_1083408832 | 3300005764 | Tropical Forest Soil | MTDTPSTIVNRTLRRQPNTAYRVREYLTDKEVDRL |
| Ga0070712_1003425905 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDTTPRAENRTLPLRQPNSAYRQREYLTENEIDRL |
| Ga0099827_113896882 | 3300009090 | Vadose Zone Soil | MTETTPIAAKRTLTRLPNAAYRPREYLTETEVERLIDAARKRG |
| Ga0126374_108230902 | 3300009792 | Tropical Forest Soil | MTDTSPTTENRTLPRRLPNSAYRVREYLTEKEVDRLIEV |
| Ga0126374_113112713 | 3300009792 | Tropical Forest Soil | MTDTTPTTENRTLPRRLPNSAYRVREYLTEKEVDRLIEAAR |
| Ga0126376_115492582 | 3300010359 | Tropical Forest Soil | MTDAAPTATNRTLRRLPNAAYRPREYLTEAEVERLIEAARK |
| Ga0126372_122263331 | 3300010360 | Tropical Forest Soil | MTDTAPTLVNRTLPRRLPNSAYRVREYLTEKEVDR |
| Ga0126372_125801761 | 3300010360 | Tropical Forest Soil | MTDTSSTTVNRTLRRLSNSAYRVREYLTEKEVDRLIEAARK |
| Ga0136449_1005352325 | 3300010379 | Peatlands Soil | MSDAAPSTTNRTLRRLPNAAYRVREYLTEAEVEQL |
| Ga0126383_115510631 | 3300010398 | Tropical Forest Soil | MTDTSPITVNRTLPTRLPNAAYRVREYLTEKEVDRLIEA |
| Ga0137378_103412371 | 3300012210 | Vadose Zone Soil | PTAVNRTLRRLPNVAYRPREYLTEKEVDRLIEAVEWLGGS* |
| Ga0126375_102236711 | 3300012948 | Tropical Forest Soil | MTDTSPTTVNRTLRRLPNQAYRPREYLTEKEVDRLIEAARKR |
| Ga0164299_104466742 | 3300012958 | Soil | MTDAAPTTENRTLRRLPNASYRQREYLTEAEVDRLIDAARKRG |
| Ga0164302_107486001 | 3300012961 | Soil | MTDAAPTTENRTLRRLPNASYRQREYLTEAEVDRLIDA |
| Ga0126369_101854285 | 3300012971 | Tropical Forest Soil | MTGTAPTTANRTLPSRLPNSAYRVREYLTVKELDRLIEAARKRGRNGARDAA |
| Ga0182036_111730162 | 3300016270 | Soil | MIDASPTTVNRTRVRKPNTAYRSREYLTEAEVIRLIETARKRGRNGA |
| Ga0182041_101430255 | 3300016294 | Soil | MSDTTPMAENRTLPRRQPNAAYRQREYLTETEVERLI |
| Ga0182033_102652724 | 3300016319 | Soil | MADAAPTTPNRTLPRRQPNTAYRQREYLTEKEVERLIEAARK |
| Ga0182033_104585271 | 3300016319 | Soil | MSDTTPMAENRTLPRRQPNAAYRQREYLTETEVERLIEAARKRG |
| Ga0182033_107636612 | 3300016319 | Soil | MTDAAPTTNLTVGRQSNAAYRPREYLTEGEVERLVETARRR |
| Ga0182033_113916361 | 3300016319 | Soil | MSDTTPMAGNRTLPRRQPNAAYRQREYLTETEVERLIEAARK |
| Ga0182035_104949551 | 3300016341 | Soil | MAEAAPTAVNRTLRRWPNAEYRPREYLTEAEVDRLIE |
| Ga0182035_108092733 | 3300016341 | Soil | MTGTTPTTENRTLRRLSNATYRPREYLTEKEVDRLIE |
| Ga0182035_114151891 | 3300016341 | Soil | MTELAPKTENRTLRRLPNAAYRSREYLTEAEVEKLIDT |
| Ga0182032_112064301 | 3300016357 | Soil | MTDTTPTTMNRTVGRLANSAYRPREYLTEAEVEKLIDAARK |
| Ga0182034_103197853 | 3300016371 | Soil | MTDTTPMAENRTLPRRQPNAAYRQREYLTESEVERLIEAAR |
| Ga0182034_112896482 | 3300016371 | Soil | MTDTSPTTVNRTLPTRLPNAAYRVREYLTEKEVDRLI |
| Ga0182034_113937872 | 3300016371 | Soil | MTDTAPITENRTLRRLPNATYRPREYLTEKEVDRLIETA |
| Ga0182040_102183053 | 3300016387 | Soil | MADAAPTTPNRTLPRRQPNTAYRQREYLTEKEVERLIEAAR |
| Ga0182040_116014971 | 3300016387 | Soil | MIDASPTTVNRTRVRKPNTAYRSREYLTEAEVIRLIETARKRGR |
| Ga0182037_108380752 | 3300016404 | Soil | MSDTTPMAENRTLPRRQPNAAYRQREYLTETEVERLIEAARK |
| Ga0182037_111792161 | 3300016404 | Soil | MSNTASTTENRTLRRLPNAAYRPREYLTEAEVERLIEAA |
| Ga0182037_121010211 | 3300016404 | Soil | MTDTTPTTMNRTVGRLANSAYRPREYLTEGEVEKLIDAARKRG |
| Ga0182039_102951372 | 3300016422 | Soil | MTDTSPATVNRTLRRFPNSAYTPREYLTEKEVDRLIEAAR |
| Ga0182039_105840824 | 3300016422 | Soil | MTDPALSAINRTLRRLPNAAYRQREYLTEAEVDRHIEAARKRG |
| Ga0182039_106349801 | 3300016422 | Soil | MTDATPTTANRTLRRLPNSTYRPREYLTEAEVERLIETARRRGRN |
| Ga0182039_115163561 | 3300016422 | Soil | MSDAAPTIGNRTLRRKPNADYRPREYLTEAEVDRLIETARKRG |
| Ga0182038_107649652 | 3300016445 | Soil | MSDTTPMAGNRTLPRRQPNAAYRQREYLTETEVERLIEAAR |
| Ga0182038_117383053 | 3300016445 | Soil | MSDTTPMAENRTLPRRQPNAAYRQREYLTETEVERLIEAARKR |
| Ga0187802_103795981 | 3300017822 | Freshwater Sediment | MSDAGPTTENRTLRRLPNAAYRQREYLTETEVEQLIDA |
| Ga0187814_104344472 | 3300017932 | Freshwater Sediment | MSDAGPTTENRTLRRLPNAAYRQREYLTETEVEQLIDAARKR |
| Ga0187778_111688952 | 3300017961 | Tropical Peatland | MSDLSPTTENRTLPRRQVNGAYRQREYLTETEVEKLIET |
| Ga0187766_114195041 | 3300018058 | Tropical Peatland | MTDTTRMVENRTLPRRQPNSAYRQREYLTESEVER |
| Ga0210402_100420293 | 3300021478 | Soil | MTEAAPTTANRTLRRLPNSAYRQREYLTEKEVERLI |
| Ga0126371_132748041 | 3300021560 | Tropical Forest Soil | MTDTSPTIVNRTLPTRLPNSAYRVREYLTEKEVDRLIETARK |
| Ga0209069_107068751 | 3300027915 | Watersheds | MTEAAPTTTNRTLRRLPNAAYRQREYLTESEVEQLVE |
| Ga0170824_1288743862 | 3300031231 | Forest Soil | MSEATSTAANRTLQRLPNAAYRPREYLTEAEVERLIEAARKRG |
| Ga0170819_111900211 | 3300031469 | Forest Soil | MNKARSTTANRPLRRLPNAAYRPREYLTEAEVERLIEAARKR |
| Ga0318573_105193562 | 3300031564 | Soil | MTEAAPTTTNRTLPRRQPIAAYRQREYLTESEVQRLIGAARKRGR |
| Ga0310915_102502432 | 3300031573 | Soil | MTDTTPTTVNRTLPTRLPNSAYRVREYLTGKEVDRLIEA |
| Ga0310915_103788932 | 3300031573 | Soil | MSDTTLMVENRTLPRRQPNAAYRQREYLTETEVERLI |
| Ga0310915_105937281 | 3300031573 | Soil | MTDASPTTENRTLRRLPNATYRPREYLTEKEVDRLIDAARKRG |
| Ga0310915_107569831 | 3300031573 | Soil | NANQHMTDAAPTAVNRTLRRLPNSTYRPREYLTEKEVDRLIETAPGG |
| Ga0318542_103088271 | 3300031668 | Soil | MTDTTPTTANRTLRRLPNAAYRVREYLTEKEVDRLIEAARK |
| Ga0306917_109421753 | 3300031719 | Soil | MSDTTPMAGNRTLPRRQPNAAYRQREYLTETEVEKLI |
| Ga0307469_122039031 | 3300031720 | Hardwood Forest Soil | MSDTTSIVVNRTLPCRQPNAAYRQREYLTETEVDR |
| Ga0306918_105772741 | 3300031744 | Soil | MSDTTLMVENRTLPRRQPNAAYRQREYLTETEVERLIEAARKRGRN |
| Ga0306918_112430332 | 3300031744 | Soil | MTDTSPAAVNRTLRRLPNSAYRVREYLTEKEVERLLETAR |
| Ga0318521_104613781 | 3300031770 | Soil | MTDTSPTTVNRTLSTRLPNSAYRVREYLTEKEVDRLIEAAR |
| Ga0318521_109971771 | 3300031770 | Soil | MADAAPTTPNRTLLRRQPNTAYRQREYLTEKEVERLIEAARKRGRNG |
| Ga0318546_105460712 | 3300031771 | Soil | MSDLSSTTANRTLMRLPNAAYRPREYLTEAEVSKLIETARKRGRNGLRD |
| Ga0318547_102183021 | 3300031781 | Soil | MADAAPTTPNRTLLRRQPNTAYRQREYLTEKEVERLIEAARKRGR |
| Ga0318497_107481701 | 3300031805 | Soil | MTDTSPTTENRTLPTRLPNSAYRVREYLTEKEVDRLIEAARQR |
| Ga0310917_105808621 | 3300031833 | Soil | MTDTSPTIVNRTLRRLPNAAYRVREYLTEKEVDRLIEAAR |
| Ga0310917_106019071 | 3300031833 | Soil | MADAAPTTPNRTLPRRQPNTAYRQREYLTEKEVERLIEA |
| Ga0310917_106838341 | 3300031833 | Soil | MTGTTPTTENRTLRRLSNATYRPREYLTEKEVDRLI |
| Ga0306919_106867221 | 3300031879 | Soil | MSDTTPMAGNRTLPRRQPNAAYRQREYLTETEVEKLIEA |
| Ga0306925_102356854 | 3300031890 | Soil | MTDATSTAVNRTLPRRLPNSTYRVREYLTEKEVDRL |
| Ga0306925_103561051 | 3300031890 | Soil | MTDTSSTIVNRTLPQRLPNAAYRVREYLTEKEVERLI |
| Ga0306925_105834101 | 3300031890 | Soil | MSEATPTTANRTLRRLPNSAYRPREYLTEQEVEKLIEAARKRGRWISRKP |
| Ga0306925_113042601 | 3300031890 | Soil | MSDTTPMAENRTLPRRQPNAAYRQREYLTETEVER |
| Ga0306923_110061042 | 3300031910 | Soil | MTEATPTMMNRTLGRLANSAYRPREYLLEGEVEKLIEAARKRGRNGPRD |
| Ga0306921_103574251 | 3300031912 | Soil | MSDTTPMAENRTLPRRQPNAAYRQREYLTETEVERL |
| Ga0310912_107755731 | 3300031941 | Soil | MSDTTPMAGNRTLPRRQPNAAYRQREYLTETEVEKLIE |
| Ga0310912_111861171 | 3300031941 | Soil | MTDTSPTTANRTLLTRLPNSAYRVREYLTEKEVDRLIEAARKRG |
| Ga0310916_117125172 | 3300031942 | Soil | MSDTTPMAGNRTLPRRQPNAAYRQREYLTETEVERLI |
| Ga0310910_109034751 | 3300031946 | Soil | MTDTSPTTENRTLRRLPNSAYRVREYLTEKEVDRLIEAARK |
| Ga0310910_109985722 | 3300031946 | Soil | MTDTAPTTENRTLRRLPNATYRPREYLTEKEVDRLIEAARKR |
| Ga0310910_114086851 | 3300031946 | Soil | MTDTAPTRVNRTLRRLPNSAYRVREYLTEKEVDRL |
| Ga0310909_110513022 | 3300031947 | Soil | MTDASPMTENRTLRRLPNSTYRLREYLTEKEVDRLIEA |
| Ga0306926_103520582 | 3300031954 | Soil | MTDTSPTTENRTLRRLPNATYRPREYLTEKEVERLIEAAR |
| Ga0306926_123871461 | 3300031954 | Soil | MTDTSPTIVNRTLPTRLPNSAYRVREYLTEKEVERLIEAAKR |
| Ga0306922_102346891 | 3300032001 | Soil | MTDTTSTTENRTLPRRLPNAAYRVREYLTEKEVDRLIEAAR |
| Ga0306922_105032352 | 3300032001 | Soil | MTDTSPTTVNRTLPTRLPNSAYRVREYLTEKEVDRLIEAARK |
| Ga0318549_103913482 | 3300032041 | Soil | MADAAPTTPNRTLLRRQPNTAYRQREYLTEKEVERLIEA |
| Ga0318558_102046062 | 3300032044 | Soil | MTDTTPTTENRTLRRLPNSTYRPREYLTEKEVDRLIE |
| Ga0318533_101271181 | 3300032059 | Soil | MTDTSPTPVNRTLPTRLPNSAYRVREYLTEKEVDRLIEAARK |
| Ga0318533_106318412 | 3300032059 | Soil | MTDTAPTTTNRTLRRLPNSAYRVREYLTEKEVDRLIEAARKRGRNGA |
| Ga0318504_105495011 | 3300032063 | Soil | MTDATSTTVNRTLPTRLPNSAYRVREYLTEKEVDR |
| Ga0306924_103799941 | 3300032076 | Soil | MTDTSSTIVNRTLPQRLPNAAYRVREYLTEKEVERLIEAARKRGRN |
| Ga0306920_10005788111 | 3300032261 | Soil | MTNPSPTTVNRTLQRLPNSSYRPREYLTEKEVDRLIE |
| Ga0306920_1042847841 | 3300032261 | Soil | MTEVAPNITNRTLLRKANSAYRPREYLLEAEVDKLIETARRRGR |
| Ga0335080_117420551 | 3300032828 | Soil | MSGTTSTTANRTLRRLANAAYRPREYLTEAEVEKLIEAAR |
| Ga0318519_106602801 | 3300033290 | Soil | MAEVAPTTVNRTLRRLPNSAYRQREYLTEAEVDRLI |
| ⦗Top⦘ |