Basic Information | |
---|---|
Family ID | F105635 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 41 residues |
Representative Sequence | LKALLADWKLVLAMGGAAIAALAMIAYAFFRPAVDPEEAERK |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 94.95 % |
% of genes near scaffold ends (potentially truncated) | 98.00 % |
% of genes from short scaffolds (< 2000 bps) | 89.00 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF01557 | FAA_hydrolase | 69.00 |
PF10370 | DUF2437 | 25.00 |
PF00227 | Proteasome | 2.00 |
PF08665 | PglZ | 1.00 |
PF13544 | Obsolete Pfam Family | 1.00 |
PF01039 | Carboxyl_trans | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 2.00 |
COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 2.00 |
COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 2.00 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 1.00 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 1.00 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.00 % |
Unclassified | root | N/A | 7.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001162|JGI12714J13572_1002957 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300001593|JGI12635J15846_10023772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4988 | Open in IMG/M |
3300004080|Ga0062385_10819792 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300004152|Ga0062386_100147490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1834 | Open in IMG/M |
3300004635|Ga0062388_101599916 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300005166|Ga0066674_10181018 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300005176|Ga0066679_10992213 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005178|Ga0066688_10403288 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
3300005181|Ga0066678_10910390 | Not Available | 575 | Open in IMG/M |
3300005518|Ga0070699_101186469 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300005537|Ga0070730_10005854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10553 | Open in IMG/M |
3300005586|Ga0066691_10405293 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300006041|Ga0075023_100283325 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300006175|Ga0070712_100530906 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300006176|Ga0070765_101161789 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300006794|Ga0066658_10149519 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300006800|Ga0066660_11413805 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006914|Ga0075436_100328539 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
3300006954|Ga0079219_11606288 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300007258|Ga0099793_10035432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2145 | Open in IMG/M |
3300007265|Ga0099794_10115613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1347 | Open in IMG/M |
3300009038|Ga0099829_11176098 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300009089|Ga0099828_10100379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2501 | Open in IMG/M |
3300009520|Ga0116214_1156459 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300010337|Ga0134062_10275373 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300010360|Ga0126372_11921088 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300011270|Ga0137391_11279568 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300011271|Ga0137393_10693324 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300011271|Ga0137393_11092605 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300011271|Ga0137393_11360845 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300012096|Ga0137389_11060668 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300012096|Ga0137389_11593525 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300012203|Ga0137399_11495732 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300012207|Ga0137381_10072057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2891 | Open in IMG/M |
3300012361|Ga0137360_11605398 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300012923|Ga0137359_11434655 | Not Available | 578 | Open in IMG/M |
3300012929|Ga0137404_10246489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1532 | Open in IMG/M |
3300012960|Ga0164301_10121308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1545 | Open in IMG/M |
3300012977|Ga0134087_10342247 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300015241|Ga0137418_10302880 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
3300015357|Ga0134072_10258507 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300016422|Ga0182039_10701322 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300017955|Ga0187817_10493181 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300017972|Ga0187781_10191219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1443 | Open in IMG/M |
3300018032|Ga0187788_10286641 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300018468|Ga0066662_10178861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1647 | Open in IMG/M |
3300018482|Ga0066669_10207382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1507 | Open in IMG/M |
3300019788|Ga0182028_1557132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2109 | Open in IMG/M |
3300019789|Ga0137408_1406186 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300020170|Ga0179594_10085719 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300020580|Ga0210403_10196328 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
3300020580|Ga0210403_10865959 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300020580|Ga0210403_11248357 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300020581|Ga0210399_10451861 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300021046|Ga0215015_10963516 | Not Available | 868 | Open in IMG/M |
3300021406|Ga0210386_11401058 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300021407|Ga0210383_10939583 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300021420|Ga0210394_10800502 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300021420|Ga0210394_11572564 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300021432|Ga0210384_10933430 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300021432|Ga0210384_11017839 | Not Available | 730 | Open in IMG/M |
3300021474|Ga0210390_10011376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7261 | Open in IMG/M |
3300021477|Ga0210398_10611383 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300022533|Ga0242662_10159028 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300022724|Ga0242665_10014481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1702 | Open in IMG/M |
3300024179|Ga0247695_1024494 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300024246|Ga0247680_1040690 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300024251|Ga0247679_1050532 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300026305|Ga0209688_1089178 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300026312|Ga0209153_1312924 | Not Available | 504 | Open in IMG/M |
3300026323|Ga0209472_1216264 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300026331|Ga0209267_1181517 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300026515|Ga0257158_1059522 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300026551|Ga0209648_10098420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2401 | Open in IMG/M |
3300027381|Ga0208983_1007602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2019 | Open in IMG/M |
3300027381|Ga0208983_1074854 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300027748|Ga0209689_1212843 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300027783|Ga0209448_10262841 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300027783|Ga0209448_10324023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
3300027862|Ga0209701_10311763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 901 | Open in IMG/M |
3300027875|Ga0209283_10109945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1808 | Open in IMG/M |
3300028808|Ga0302228_10112384 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
3300029636|Ga0222749_10528347 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300030503|Ga0311370_11451308 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300030862|Ga0265753_1050830 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300030878|Ga0265770_1124809 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300031231|Ga0170824_117478522 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300031715|Ga0307476_10830620 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300031753|Ga0307477_10930961 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300031823|Ga0307478_11669034 | Not Available | 525 | Open in IMG/M |
3300031846|Ga0318512_10314610 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300031947|Ga0310909_10691967 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300032059|Ga0318533_10219973 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
3300032174|Ga0307470_11015392 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300032205|Ga0307472_100806197 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300032205|Ga0307472_101477739 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300032782|Ga0335082_11514082 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300032783|Ga0335079_12103074 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300032955|Ga0335076_10104968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2753 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.00% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001162 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12714J13572_10029571 | 3300001162 | Forest Soil | LKALLADWELLLAMGGALIAALAMIAYAFLRPAPNPEEEERK |
JGI12635J15846_100237721 | 3300001593 | Forest Soil | LNTLLADWRLVLGMGGALIAALAMIVYAFLRPAVNPE |
Ga0062385_108197922 | 3300004080 | Bog Forest Soil | LKALFADWKLVLAMAGAAIAAIMMIAYAFFHPAEEPEDVERRRR |
Ga0062386_1001474901 | 3300004152 | Bog Forest Soil | LKALFADWKLVLAMAGAGLAAVAMIVYAFFRPAEDTEAAE |
Ga0062388_1015999161 | 3300004635 | Bog Forest Soil | LSALLADWKLTLSMAAAALAAVAMVAYAFFRPAVDMVGAERK |
Ga0066674_101810182 | 3300005166 | Soil | LKELLVDWKLMLAMGGAAIAALAMITYAFFRPAEDPEEAERKRRL |
Ga0066679_109922132 | 3300005176 | Soil | LKELLVDWKLMLAMGGAAIAALAMIAYAFFRPAEDPEEAERKRRLHLNQIG |
Ga0066688_104032882 | 3300005178 | Soil | LNALLADWKLVLAMGGALIAALAMIAYAFLRPEANPEEEERKRRLHLNQ |
Ga0066678_109103902 | 3300005181 | Soil | LKALLADWKLVLAMGGAAIAALAMIAYAFFRPAVDPEEAERK |
Ga0070699_1011864692 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LKSLFADWKLVLAMGAAAIAAIAMIAYAFFRPAEEPEDVERRRRLHL |
Ga0070730_100058541 | 3300005537 | Surface Soil | LLIALPADWKLMLAMGGAAVAAVAMIVYAFLRPEGDPEAEERKRRLHL |
Ga0066694_101951302 | 3300005574 | Soil | LKILASDWKLILMMGIAAIAAISMIAYAFFRPTEHPEDAERKRR |
Ga0066691_104052932 | 3300005586 | Soil | LKELFADWKLVLAMGGAAIAAMAMIAYAFFRPAVN |
Ga0075023_1002833251 | 3300006041 | Watersheds | LKALFADWKLVLAMVGALIAGVGMIVYAFLRPAVNPEAE |
Ga0070712_1005309062 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LKDLLADWKMLLTIGGGSLAALAMIAYAFVRPAVNP |
Ga0070765_1011617892 | 3300006176 | Soil | LKTLLAEWKIVLAMCGAAVAALAMIAYAFFRPAEPAENVERKRRLHLNQ |
Ga0066658_101495193 | 3300006794 | Soil | LKELLADWKLLLVMGGAAIAALAMIAYAFFRPAVDPE |
Ga0066660_114138052 | 3300006800 | Soil | LKALLADWKLVLAMGGALIAALVMIAYAFLRPTADPEEEE |
Ga0075436_1003285392 | 3300006914 | Populus Rhizosphere | LTIALPADWKLLLAMGGAAIAAVAMIVYAFLRPEGDPEAEERKRR |
Ga0079219_116062882 | 3300006954 | Agricultural Soil | LKALLADWKLVLVMGGAAIAAVAMIVYAFLRPAEDPEAEERKRRLHLNQ |
Ga0099793_100354324 | 3300007258 | Vadose Zone Soil | LKALLADWKLVLAMGGAAIAALAMIVYAFFRPPVNPEEEER |
Ga0099794_101156133 | 3300007265 | Vadose Zone Soil | LKALLADWKVVLAMGGAAAAALALIVYAFLRPAVNPEEEE |
Ga0099829_111760981 | 3300009038 | Vadose Zone Soil | LKALLADWKLVLAMGGAAIAAVAMIAYAFLRPAVDPEEEERKRRLHLN |
Ga0099828_101003791 | 3300009089 | Vadose Zone Soil | LKELLADWKLVLGMGGAAIAALAMIAYAFFRPAVNPEEEERKRRLHLNQ |
Ga0116214_11564591 | 3300009520 | Peatlands Soil | LKELFADWKMMLGMGGALIAAVAMIAYAFFRPALNPEEEERKRRLHL |
Ga0134062_102753732 | 3300010337 | Grasslands Soil | LKALLADWKLVLAMGGALIAALAMIAYAFLRPAADPEEEE |
Ga0126372_119210882 | 3300010360 | Tropical Forest Soil | LPADWKLVLAMGGAAIAAVAMIVYAFLRPEGDPEAEERKRRLH |
Ga0137391_112795681 | 3300011270 | Vadose Zone Soil | LKALLADWKVVLAMGAAAIAAVAMIVYAFLRPAVNPEEEERKRRLHLNQ |
Ga0137393_106933242 | 3300011271 | Vadose Zone Soil | LKELLADWKLVLALGGAAVAALAMIVYAFFRPAVDPEEAE |
Ga0137393_110926052 | 3300011271 | Vadose Zone Soil | MFADWKVVLAVGGAVIAALAMIVYAFFGPAVDPEE |
Ga0137393_113608452 | 3300011271 | Vadose Zone Soil | LKALLADWKLVLAMGGALIAALAMIAYAFLRPAVNPEEE |
Ga0137389_110606682 | 3300012096 | Vadose Zone Soil | LKELLADWKLVLALGGAAVAALAMIVYAFFRPAVDPE |
Ga0137389_115935251 | 3300012096 | Vadose Zone Soil | LKALLADWKLVLAMGGAAIAAVAMIAYAFLRPAVDPEEEE |
Ga0137399_114957321 | 3300012203 | Vadose Zone Soil | LKELLADWKLVLMIGGGSLAALALIAYAFARPAAD |
Ga0137381_100720575 | 3300012207 | Vadose Zone Soil | LKELLADWKVVLAMGGAAIAAFAMIAYAFFRPAEDP |
Ga0137360_116053981 | 3300012361 | Vadose Zone Soil | LKELLADWKFVLAMGGAAIAAIAMIAYAFFRPALNPEEEER |
Ga0137359_114346551 | 3300012923 | Vadose Zone Soil | LKALLADWKLVLTMGGAAIAGLAMIAYAFFRPAVNPEDAERK |
Ga0137404_102464893 | 3300012929 | Vadose Zone Soil | LKALFADWKLVLAMGGAAIAALAMIAYAFFRPAVDPEE |
Ga0164301_101213083 | 3300012960 | Soil | LKSLFADWKLVLAMAGAAIAAIAMIAYAFFRPAEEPEDLER |
Ga0134087_103422472 | 3300012977 | Grasslands Soil | LKELLVDWKLMLAMGGAAIAALAMIAYAFFRPAED |
Ga0137418_103028803 | 3300015241 | Vadose Zone Soil | LKELLADWKLLLMIGGGSLAALALIAYAFARPAADPEAEER |
Ga0134072_102585071 | 3300015357 | Grasslands Soil | MLADWKLVLVMGGAAIAAVAMIVYAFLRPEGDPEDQERRRRL |
Ga0182039_107013222 | 3300016422 | Soil | MLGDFKFVLAIGGAAIAAVAMIVYAFLRPEGDPEDQE |
Ga0187817_104931812 | 3300017955 | Freshwater Sediment | LKNLLADWKLVLAMGGAAIAAIAMIAYAFFRPAED |
Ga0187781_101912191 | 3300017972 | Tropical Peatland | LKELLADWKLLLALVGGSVAAMALIVYAFVRPAVDPAAEERKRRL |
Ga0187788_102866411 | 3300018032 | Tropical Peatland | VEKFLADWKMALAMGGAAVAAIAMIAYAFFRPAEDPEAVERKRRL |
Ga0066662_101788611 | 3300018468 | Grasslands Soil | LKELLADWKLVLALAGAAVAALAMIVYAFLRPTVDPEEPER |
Ga0066669_102073821 | 3300018482 | Grasslands Soil | LKDWLADWKLMLARGGAAIDALAMVAYAFLRPAVNPEE |
Ga0182028_15571325 | 3300019788 | Fen | MLLALAGGCAAAIALIVYAFVRPAVDPEAEERKRRLH |
Ga0137408_14061862 | 3300019789 | Vadose Zone Soil | LKELFADWKLVLGMGGALVAALAMIGYAFFRPAVNPEDEERKRRLH |
Ga0179594_100857191 | 3300020170 | Vadose Zone Soil | LLKDLLADWKLMLVMGGAAIAAFAMIAYAFFRPGV |
Ga0210403_101963281 | 3300020580 | Soil | LKELLADWKLLLMIGGGSLAALALIAYAFARPAADPAAEERKR |
Ga0210403_108659591 | 3300020580 | Soil | LKDLLADWKLLLAMGGAAIAGLALVAYAFFRPAANPEE |
Ga0210403_112483572 | 3300020580 | Soil | LKALLADWKLVLAMVAAALGGVAMIVYAFLRPAVNPEAEERKRRLHLNQIG |
Ga0210399_104518611 | 3300020581 | Soil | LQALLADWKLILTMGCAAIAALAMIAYAFFRPAVDPYEA |
Ga0215015_109635161 | 3300021046 | Soil | LNSFLADWKLTLALVCAAIAAIAMIAYAFIRPAVDPEEDERKRRLH |
Ga0210386_114010581 | 3300021406 | Soil | LKALFADWKVVLAMAGAAIAAIMMIAYAFFHPAEEPEDVERRRRLHLN |
Ga0210383_109395832 | 3300021407 | Soil | LRELLADWKLLLMIGGGSLAALALIAYAFARPAADPEAEE |
Ga0210394_108005022 | 3300021420 | Soil | LQALLADWKLLLTMGGAAIAALAMIAYAFFRPAVNP |
Ga0210394_115725642 | 3300021420 | Soil | LKALLADWKVVLVMVGVGVAAVAMIVYAFFRPAEDPEAA |
Ga0210384_109334302 | 3300021432 | Soil | LKALLADWKLALAMAGAAVAAVAMIAYAFFRPAEDQEG |
Ga0210384_110178392 | 3300021432 | Soil | LKALFTDWKLVLAMGGAALAAILMIAYAFFRPAEEP |
Ga0210390_100113761 | 3300021474 | Soil | LKGLFADWKLVLAMGGAALAAILMIAYAFFRPAEEPEDVER |
Ga0210398_106113831 | 3300021477 | Soil | LKALFADWKVVLAMAGAAIAAILMIAYAFFHPAEEPEDVER |
Ga0242662_101590281 | 3300022533 | Soil | LKALLADWKVVLVMVGVGVAAVAMIVYAFFRPAEDPEAAERKRRLHLNQ |
Ga0242665_100144811 | 3300022724 | Soil | LKALLADWKLVLAMGGAAVAALAMIAYAFLRPAEDPEATERRR |
Ga0247695_10244941 | 3300024179 | Soil | LKELLADWKLLLMIGGGSLAALALIAYAFARPAAD |
Ga0247680_10406901 | 3300024246 | Soil | LKSLFADWKLVLAMAGAAIAAIAMIAYAFFRPAEEPEDVER |
Ga0247679_10505322 | 3300024251 | Soil | LKSLFADWKLVLAMAGAAIVAIAMIAYAFFRPAEEPQDVERRR |
Ga0209688_10891781 | 3300026305 | Soil | MLADWKLVLVMGGAAIAAVAMIVYAFLRPEGDPEDQERRRRLHLN |
Ga0209153_13129241 | 3300026312 | Soil | LIVLLDDWKLWLAMGGAAVAAVAMIVYAFLRPEGDPEAEERKRR |
Ga0209472_12162642 | 3300026323 | Soil | LKAWLADWKLMLAMGGAAIAALAMVAYAFLRPAVNPE |
Ga0209267_11815172 | 3300026331 | Soil | LLNALLADWKLVLAMGGALIAALAMIAYAFLRPEANPEEEERKRRLHLNQ |
Ga0257158_10595221 | 3300026515 | Soil | LKELFADWKLVLGMGGALVAAVAMIAYAFFRPAVNPEDEERKRRLHLNQ |
Ga0209648_100984204 | 3300026551 | Grasslands Soil | LKEIFADWKFVLAMGGAAIAAIAMIAYAFFRPALNPEEEERRRRLHLN |
Ga0208983_10076024 | 3300027381 | Forest Soil | LKELFADWKLVLGMGGALVAAVAMIAYAFFRPAVNPEDEERKRR |
Ga0208983_10748542 | 3300027381 | Forest Soil | LKELLADWKLVLMIGGGSLAALALIAYAFARPAADPE |
Ga0209689_12128432 | 3300027748 | Soil | LKAWLGDWKLMLAMGGAAIAALAMVAYAFLRPAVNPEE |
Ga0209448_102628411 | 3300027783 | Bog Forest Soil | LKALFADWKVVLAMAGAAIAAILMIAYAFFRPAEEAEDVERR |
Ga0209448_103240232 | 3300027783 | Bog Forest Soil | LNALLADWKLTLSVVGAAAAAVAMVAYAFFRPAVDM |
Ga0209701_103117632 | 3300027862 | Vadose Zone Soil | LKALFADWKLELAMGGAALAAIAMVVYAFLRPSVDPETEERKRRL |
Ga0209283_101099451 | 3300027875 | Vadose Zone Soil | LKELLADWKLVLGMGGAAIAALAMIAYAFFRPAVNPEEEERKRRL |
Ga0302228_101123843 | 3300028808 | Palsa | LNALLADWKLTLATCAGVVAAIAMVAYAFLRPAVDMVEAERKRRLHL |
Ga0222749_105283472 | 3300029636 | Soil | LKALLADWELLLAMGGALIAALAMIAYAFLRPAPNPEEEERKRR |
Ga0311370_114513081 | 3300030503 | Palsa | LNALLADWKLTLATCAGVVAAIAMVAYAFLRPAVDMVEAERKR |
Ga0265753_10508302 | 3300030862 | Soil | LKALFADWKVVLAMAGAAIAAIMMIAYAFFRPAEEAED |
Ga0265770_11248091 | 3300030878 | Soil | LKALFADWKVVLAMAGAAIAAILMIAYAFFRPAEEPED |
Ga0170824_1174785222 | 3300031231 | Forest Soil | LKDLLADWKMLLAIGGGSLAALAMIAYAFVRPAVNPEEEERKR |
Ga0307476_108306202 | 3300031715 | Hardwood Forest Soil | LKELLADWKLLLMIGGGSLAALALIAYAFARPAADPEA |
Ga0307477_109309612 | 3300031753 | Hardwood Forest Soil | LKDLLADWKLMLVMGGAAIAAVAMIAYAFFRPPVDPEEEE |
Ga0307478_116690341 | 3300031823 | Hardwood Forest Soil | LKALFADWKVLLAMVGAGVAAVAMIVYAFFRPTEDPE |
Ga0318512_103146101 | 3300031846 | Soil | MLADWKLVLVMGGAAVAAVAMIVYAFLRPEGDPEDEERK |
Ga0310909_106919671 | 3300031947 | Soil | MLADWKLVLVMGGAAVAAVAMIVYAFLRPEGDPEDEERKRRLHLNQ |
Ga0318533_102199731 | 3300032059 | Soil | LKDLLADWKMLLTIGGGSLAALAMIAYAFVRPAVNPEEEE |
Ga0307470_110153921 | 3300032174 | Hardwood Forest Soil | LKELLADWKVLLMIGGGSLAALALIAYAFAQPAADP |
Ga0307472_1008061971 | 3300032205 | Hardwood Forest Soil | LLIALPADWKLLLAMGGAAIAAVAMIVYAFLRPEGDPEAEERK |
Ga0307472_1014777391 | 3300032205 | Hardwood Forest Soil | LKDLLADWKMLLAIGGGSLAALAMMAYAFVRPAVNP |
Ga0335082_115140821 | 3300032782 | Soil | LKELLADWKLVLAFAGGSVAVILLLVYAFLRPTENPEETERKRRLH |
Ga0335079_121030741 | 3300032783 | Soil | LKELLADWKMLLAIGGGSLAALAMIAYAFVRPAVNPEEEE |
Ga0335076_101049684 | 3300032955 | Soil | MLADWKLVLAMVGAAIVAIAMIAYAFIRPEETPEEAERKRRLHL |
⦗Top⦘ |