Basic Information | |
---|---|
Family ID | F105623 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 38 residues |
Representative Sequence | MATQTATLARPVAPASAGVLLPAFTLWWREIVRFYRQ |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 67.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 93.00 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.15% β-sheet: 0.00% Coil/Unstructured: 73.85% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF13732 | DUF4162 | 23.00 |
PF00005 | ABC_tran | 15.00 |
PF01161 | PBP | 2.00 |
PF07883 | Cupin_2 | 2.00 |
PF13620 | CarboxypepD_reg | 2.00 |
PF00033 | Cytochrome_B | 1.00 |
PF07690 | MFS_1 | 1.00 |
PF13432 | TPR_16 | 1.00 |
PF13304 | AAA_21 | 1.00 |
PF14559 | TPR_19 | 1.00 |
PF02628 | COX15-CtaA | 1.00 |
PF13462 | Thioredoxin_4 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 2.00 |
COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 1.00 |
COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10749376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 561 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101504463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
3300002568|C688J35102_118388557 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300004092|Ga0062389_103908912 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300004468|Ga0068977_1207729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300005542|Ga0070732_10786900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 580 | Open in IMG/M |
3300005764|Ga0066903_100225092 | All Organisms → cellular organisms → Bacteria | 2851 | Open in IMG/M |
3300005938|Ga0066795_10235026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 543 | Open in IMG/M |
3300006028|Ga0070717_10513206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1084 | Open in IMG/M |
3300006046|Ga0066652_100571567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 1062 | Open in IMG/M |
3300006050|Ga0075028_100829017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 565 | Open in IMG/M |
3300006059|Ga0075017_100500406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 922 | Open in IMG/M |
3300006102|Ga0075015_100069154 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
3300006175|Ga0070712_101109727 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300006176|Ga0070765_100053493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 3307 | Open in IMG/M |
3300006176|Ga0070765_101868316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 563 | Open in IMG/M |
3300006755|Ga0079222_10808856 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300006893|Ga0073928_10585040 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300007788|Ga0099795_10136862 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica bacterium GWA2_52_8 | 993 | Open in IMG/M |
3300009638|Ga0116113_1152371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300009644|Ga0116121_1284773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
3300009824|Ga0116219_10109611 | All Organisms → cellular organisms → Bacteria | 1609 | Open in IMG/M |
3300009839|Ga0116223_10311517 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300010398|Ga0126383_10289169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1630 | Open in IMG/M |
3300010398|Ga0126383_12926991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300011271|Ga0137393_10771244 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5 | 822 | Open in IMG/M |
3300012359|Ga0137385_11012508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 685 | Open in IMG/M |
3300012362|Ga0137361_11970203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300012917|Ga0137395_10898882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300012925|Ga0137419_10692631 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300012958|Ga0164299_11571997 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300013306|Ga0163162_11834798 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300014654|Ga0181525_10184217 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5 | 1142 | Open in IMG/M |
3300017823|Ga0187818_10395680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300017924|Ga0187820_1269769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300017932|Ga0187814_10373905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300017933|Ga0187801_10071996 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1281 | Open in IMG/M |
3300017936|Ga0187821_10124724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
3300017955|Ga0187817_10104234 | All Organisms → cellular organisms → Bacteria | 1786 | Open in IMG/M |
3300017955|Ga0187817_10922149 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300018006|Ga0187804_10131526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
3300018022|Ga0187864_10323887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
3300018038|Ga0187855_10157307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1353 | Open in IMG/M |
3300018043|Ga0187887_10838422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
3300018044|Ga0187890_10301161 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300018057|Ga0187858_10095607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2035 | Open in IMG/M |
3300018086|Ga0187769_11067944 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
3300018468|Ga0066662_12870210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300018482|Ga0066669_11698478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
3300020583|Ga0210401_10294653 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
3300020583|Ga0210401_10758262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
3300021088|Ga0210404_10525322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
3300021171|Ga0210405_10358705 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300021171|Ga0210405_10563608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
3300021401|Ga0210393_10773489 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300021401|Ga0210393_11278256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300021405|Ga0210387_10239371 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
3300021420|Ga0210394_10181481 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
3300021560|Ga0126371_10609624 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
3300023077|Ga0247802_1027461 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300025898|Ga0207692_10255065 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300025906|Ga0207699_11190954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300025906|Ga0207699_11322193 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300025928|Ga0207700_11871247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300026507|Ga0257165_1058579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
3300026527|Ga0209059_1280014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300027591|Ga0209733_1129528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300027662|Ga0208565_1170379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300027882|Ga0209590_10965543 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300027884|Ga0209275_10472359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
3300027905|Ga0209415_10157973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2257 | Open in IMG/M |
3300027905|Ga0209415_10772227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 674 | Open in IMG/M |
3300027908|Ga0209006_11373401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
3300027911|Ga0209698_10988333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300028047|Ga0209526_10713303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
3300028380|Ga0268265_11901505 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300028574|Ga0302153_10030821 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
3300028871|Ga0302230_10311986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300029636|Ga0222749_10335472 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300029951|Ga0311371_10003667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 33077 | Open in IMG/M |
3300029980|Ga0302298_10090713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 952 | Open in IMG/M |
3300030294|Ga0311349_10304096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1506 | Open in IMG/M |
3300030618|Ga0311354_11929353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300030706|Ga0310039_10167300 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300030730|Ga0307482_1235617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300031028|Ga0302180_10119322 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → unclassified Planctomycetia → Planctomycetia bacterium 21-64-5 | 1491 | Open in IMG/M |
3300031028|Ga0302180_10318608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
3300031231|Ga0170824_104302385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300031233|Ga0302307_10031311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2918 | Open in IMG/M |
3300031251|Ga0265327_10482991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 534 | Open in IMG/M |
3300031525|Ga0302326_10637938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1573 | Open in IMG/M |
3300031715|Ga0307476_10622802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 800 | Open in IMG/M |
3300031945|Ga0310913_11238046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300032001|Ga0306922_12061146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
3300032035|Ga0310911_10858565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300032094|Ga0318540_10019559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2802 | Open in IMG/M |
3300032515|Ga0348332_12273135 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300032783|Ga0335079_10258061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1914 | Open in IMG/M |
3300032892|Ga0335081_12666660 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300033561|Ga0371490_1139479 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 8.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.00% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.00% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.00% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.00% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.00% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.00% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.00% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.00% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.00% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004468 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_107493761 | 3300001593 | Forest Soil | MATQTATFPATTPASAGVLLPAFTLWWREIVRFYRQRA |
JGIcombinedJ26739_1015044633 | 3300002245 | Forest Soil | MATATQTTTLARPAEAVSAGVMLPAFTLWWREIVRF |
C688J35102_1183885571 | 3300002568 | Soil | MATQVATLPRRGVRTSTGVMLPAFTLWWREIVRFYRQTGRVIG |
Ga0062389_1039089121 | 3300004092 | Bog Forest Soil | MATQTTTFRPTATTPVSAGVLLPAFTLWWREIVRFYRQRA |
Ga0068977_12077291 | 3300004468 | Peatlands Soil | MATQTAAIARPVASASAGISLPAFTLWWREIVRFYRQKSRV |
Ga0070732_107869003 | 3300005542 | Surface Soil | MATQAATLARPTTPASAGLVLPAFTLWWREIVRFYRQ |
Ga0066903_1002250921 | 3300005764 | Tropical Forest Soil | MATQAATLARPTAPASAGILLPAFTLWWREIVRFY |
Ga0066795_102350262 | 3300005938 | Soil | MATTQTTALPAPTSGSNAGLLLPSFSLWWREIVRFYRQRA |
Ga0070717_105132061 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VVTQSATLPVYATTTGIMLPAFTLWWRELVRFYRQRAR |
Ga0066652_1005715672 | 3300006046 | Soil | MASATAALPRTAGSANEELLLPAFTLWWREVVRFYR |
Ga0075028_1008290171 | 3300006050 | Watersheds | MATQSATLPPAALPASNGIALPAYTLWLREVVRFYRQRSRV |
Ga0075017_1005004062 | 3300006059 | Watersheds | MATQTVTLPAAAPASAGVLLPAFTLWWREVVRFYRQRAR |
Ga0075015_1000691541 | 3300006102 | Watersheds | MATQTATFPAAAPASAGVLLPAFTLWWREVVRFYRQ |
Ga0070712_1011097273 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MATQVATLARPGVRTSTGVMLPAFTLWWREIVRFYRQTG |
Ga0070765_1000534931 | 3300006176 | Soil | VATRAAALSRPAAPASAGILLPALTLWWREIVRFYRQKAR |
Ga0070765_1018683163 | 3300006176 | Soil | MATRAATLPGPISTGVSLPAFTLWWREIVRFYRQRSR |
Ga0079222_108088563 | 3300006755 | Agricultural Soil | MATQSATLARPAGGQASAGVLLPAFTLWWREIVRFYR |
Ga0073928_105850402 | 3300006893 | Iron-Sulfur Acid Spring | MATTVATRTGNFPTTTTAPASAGVLLPAFTLWWREIVRFYRQRARV |
Ga0099795_101368621 | 3300007788 | Vadose Zone Soil | MASASIPGPYAQSVGVMLPAFTLWWREVVRFYRQRARV |
Ga0116113_11523711 | 3300009638 | Peatland | MATQTATLVRPIAPVSTGVLLPAFTLWWREIVRFYRQ |
Ga0116121_12847733 | 3300009644 | Peatland | MATQATTLARPLAPASAGVLLPAFTLWWREIVRFYRQ |
Ga0116219_101096113 | 3300009824 | Peatlands Soil | MATQATTLARPMAPASAGVILPAFTLWWREIVRFYRQ |
Ga0116223_103115173 | 3300009839 | Peatlands Soil | MATQATTIARPLPQASAGVLLPAFTLWWREIVRFYRQTT |
Ga0126383_102891693 | 3300010398 | Tropical Forest Soil | VATQTAAIPAPIAPTSSGIFLPAFTLWWRELVRFYRQ |
Ga0126383_129269913 | 3300010398 | Tropical Forest Soil | MATQSVALTRPATRSSARVVMPAFTLWWREIVRFYRQPGRIVG |
Ga0137393_107712441 | 3300011271 | Vadose Zone Soil | MATASIPATYPQSAGVMLPAFTLWWREVVRFYRQR |
Ga0137385_110125081 | 3300012359 | Vadose Zone Soil | MATQAPTLARPMAPASAGVMLPAFTLWWREIVRFY |
Ga0137361_119702032 | 3300012362 | Vadose Zone Soil | VATQSATLPTHATPTASVLLPAFTLWWRELVRFYRQ |
Ga0137395_108988822 | 3300012917 | Vadose Zone Soil | MATQTATFPATTPASAGVLLPAFTLWWREIVRFYR |
Ga0137419_106926311 | 3300012925 | Vadose Zone Soil | MVTQSTTFSAQSASLSTELLLPAFTLWWREIVRFYRQ |
Ga0164299_115719972 | 3300012958 | Soil | MATRTATLPVAAPVSAGLMLPAYTLWLREIVRFYRQ |
Ga0163162_118347981 | 3300013306 | Switchgrass Rhizosphere | MATQTATFPARAVPASNSLVLPAFTLWWRECVRFYRQR |
Ga0181525_101842171 | 3300014654 | Bog | MATQTATFPRTATAPASAGLLLPAFTLWWREIVRF |
Ga0187818_103956803 | 3300017823 | Freshwater Sediment | MATQTATATLARPAKLASTGVMLPAFTLWWREIVRFYR |
Ga0187820_12697693 | 3300017924 | Freshwater Sediment | MATQVATLPRSGVRTSTGVMLPAFTLWWREIVRFYR |
Ga0187814_103739051 | 3300017932 | Freshwater Sediment | MATPATTLAHPMRSGSTGVALPAFTLWWREIVSFYRQTTRV |
Ga0187801_100719962 | 3300017933 | Freshwater Sediment | MATQTATFPATAPASSGLLLPAFTLWWREVVRFYRQKA |
Ga0187821_101247243 | 3300017936 | Freshwater Sediment | VATHTATARLPVRTAPASAGITLPAFTLWWRELVRFYR |
Ga0187817_101042341 | 3300017955 | Freshwater Sediment | MATPATIPARPMRSASTGVALPAFTLWWREIVRFYRQTTR |
Ga0187817_109221491 | 3300017955 | Freshwater Sediment | MATQSATFLATAPASAGLLLPAFTLWWREVVRFYR |
Ga0187804_101315261 | 3300018006 | Freshwater Sediment | MATQAATLPRSIAPASAGVTLPAFTLWWREIVRFY |
Ga0187864_103238871 | 3300018022 | Peatland | MATQSATFPATAPVSAGVLLPAFTLWWREVVRFYRQRAR |
Ga0187855_101573072 | 3300018038 | Peatland | MSTQAATFPATDPASAGVMLPAFTLWWREVVRFYRQRARV |
Ga0187887_108384221 | 3300018043 | Peatland | MATRAVALSRPGLPASAGVLLPAFTLWWREIVRFYRQKTR |
Ga0187890_103011611 | 3300018044 | Peatland | MATQATTLARPLAPASAGVLLPAFTLWWREIVRFYRQPGR |
Ga0187858_100956074 | 3300018057 | Peatland | LNFVATQTAALSRPITPASAGVLLPAFTLWWREIVRFYRQ |
Ga0187769_110679441 | 3300018086 | Tropical Peatland | MATQTATFPASAPASAGVLLPAFTLWWREVVRFYRQRAR |
Ga0066662_128702101 | 3300018468 | Grasslands Soil | MATQVATLPRRGVRTSTGVMLPAFTLWWREIVRFY |
Ga0066669_116984783 | 3300018482 | Grasslands Soil | MATQAATFARPTTPSSAGVLLPAFTLWWREIVRFYRQPGRV |
Ga0210401_102946531 | 3300020583 | Soil | LNVVATQTAALSRPVAPASAGILLPAFTLWWREIVRFYRQK |
Ga0210401_107582623 | 3300020583 | Soil | MATHATAFSRPAVPVSVGLALPAFTLWWREIVRFYRQKA |
Ga0210404_105253221 | 3300021088 | Soil | MATQATTLPRPILPASAGVLLPAFTLWWREIVRFY |
Ga0210405_103587051 | 3300021171 | Soil | MTTQATTLPRPILPASAGVLLPAFTLWWREIVRFYRQPT |
Ga0210405_105636083 | 3300021171 | Soil | MATHTTALLRPVVPVSVGLALPAFTLWWREIVRFYRQ |
Ga0210393_107734893 | 3300021401 | Soil | VATKAAALSRPAAPASAGILLPAFTLWWREIVRFYRQKA |
Ga0210393_112782563 | 3300021401 | Soil | MASRAASLPTPISAGIVLPAFTLWWREIVRFYRQRS |
Ga0210387_102393711 | 3300021405 | Soil | VATKAAALSRPAAPASAGILLPAFTLWWREIVRFY |
Ga0210394_101814814 | 3300021420 | Soil | LNVVATQTAALSRPVAPASAGILLPAFTLWWREIVRFYRQKSR |
Ga0126371_106096243 | 3300021560 | Tropical Forest Soil | MATQAATFARPTSPASAGILLPAFTLWWREIVRFYR |
Ga0247802_10274611 | 3300023077 | Soil | VVTQTATLPAHAAPTTGVMLPAFTLWWRELVRFYRQR |
Ga0207692_102550653 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MATQTATLSRPLAPASAGVMLPAFTLWWREIVRFYRQKSR |
Ga0207699_111909543 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MATQLATLPRPGVRTSTGVMLPAFTLWWREIVRFYRQ |
Ga0207699_113221932 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MATRTATLPVAAPVSAGLMLPAYTLWLREIVRFYR |
Ga0207700_118712473 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MATQLATLPHSAVRTSTGVMLPAFTLWWREIVRFYRQTG |
Ga0257165_10585792 | 3300026507 | Soil | MATQTATFPATAPASAGVLLPAFTLWWREIVRFYRQR |
Ga0209059_12800143 | 3300026527 | Soil | MATQATTLTRPMASASAGVLLPAFTLWWREIVRFYRQPG |
Ga0209733_11295281 | 3300027591 | Forest Soil | MATQTAAISRPLAPASAGILLPAFTLWWREIVRFYRQKT |
Ga0208565_11703791 | 3300027662 | Peatlands Soil | MATQATTIARPLPQASAGVLLPAFTLWWREIVRFY |
Ga0209590_109655431 | 3300027882 | Vadose Zone Soil | MATQTTTVSAQITAASKGVLLPAFTLWWREIVRFYR |
Ga0209275_104723591 | 3300027884 | Soil | MATQAATFSRPMAPASAGVVLPAFTLWWREIVRFYRQP |
Ga0209415_101579731 | 3300027905 | Peatlands Soil | MATSATTLARPKRPASVGVMLPAFTLWWREIVRFYRQPT |
Ga0209415_107722271 | 3300027905 | Peatlands Soil | MATQAATLARPTAQASAGVLLPAFTLWWREIVRFYRQTTRVIG |
Ga0209006_113734011 | 3300027908 | Forest Soil | MSTQTATFPAAVTAPASAGILLSAFTLWWREIVRFYRQR |
Ga0209698_109883331 | 3300027911 | Watersheds | MATQAATLARPTTHASAGVLLPAFTLWWREIVRFYRQTTRVI |
Ga0209526_107133033 | 3300028047 | Forest Soil | MATQTVALSRPATPASAGVLLPAFTLWWREIVRFYRQKS |
Ga0268265_119015052 | 3300028380 | Switchgrass Rhizosphere | MATQTATLPTRVIPSHDGILLPAFTLWWREIVRFYRQRARV |
Ga0302153_100308213 | 3300028574 | Bog | MATQTATFPAATSAPVSAGVLLPAFTLWWREIVRFY |
Ga0302230_103119863 | 3300028871 | Palsa | LNFVATQTAALSRPIAPASAGVLLPAFTLWWREIVRFYRQKSR |
Ga0222749_103354721 | 3300029636 | Soil | MATQAATLMTARPVSSASAGVVLPSFTLWWREIVRFYRQPAR |
Ga0311371_100036671 | 3300029951 | Palsa | LNFVATQTAALSRPIAPASAGVLLPAFTLWWREIVRFYRQK |
Ga0302298_100907131 | 3300029980 | Fen | MATAAIPASRAPSVGVLLPAFTLWWREVVRFYRQRGRVA |
Ga0311349_103040963 | 3300030294 | Fen | MSTASIPMNAAPSAGVSLPAFTLWWREIVRFYRQP |
Ga0311354_119293531 | 3300030618 | Palsa | MATQTATFPATVPASAGVLLPAFTLWWREIVRFYRQRA |
Ga0310039_101673003 | 3300030706 | Peatlands Soil | MATQATTLARPMAPASAGVILPAFTLWWREIVRFYRQPM |
Ga0307482_12356173 | 3300030730 | Hardwood Forest Soil | MATQAATFARPTTPSSAGVLLPAFTLWWREIVRFYRQP |
Ga0302180_101193223 | 3300031028 | Palsa | MATQTATFPATAPASAGVLLPAFTLWWREVVRFYRQRARV |
Ga0302180_103186081 | 3300031028 | Palsa | MATQTATLARPVAPASAGVLLPAFTLWWREIVRFYRQ |
Ga0170824_1043023851 | 3300031231 | Forest Soil | MATQATTLGRPAPPASAGVTLPAFTLWWREIVRFYRQPTRVV |
Ga0302307_100313111 | 3300031233 | Palsa | MATQSTALARPIAAPSVGLLLPAFTLWWREIVRFYRQKTRV |
Ga0265327_104829911 | 3300031251 | Rhizosphere | MATRTQVLPAAVSLPKSAGILMPATALWWREVVRFYRQRARVVG |
Ga0302326_106379383 | 3300031525 | Palsa | MATQTATYPATATAPASAGVLLPAFTLWWREIVRFYRQR |
Ga0307476_106228021 | 3300031715 | Hardwood Forest Soil | MATQTAALSRPLAPSSTGILLPAFTLWWREIVRFYRQ |
Ga0310913_112380463 | 3300031945 | Soil | MASQAAALPRPITYPSAGVVLPAFTLWWREIVRFYRQTGR |
Ga0306922_120611463 | 3300032001 | Soil | MATQAATLARPSTAPASAGIVLPSFTLWWREIVRFYRQPGRVV |
Ga0310911_108585652 | 3300032035 | Soil | MTALAAQTTTLSRSATLASVGVSLPAFTLWWRELVR |
Ga0318540_100195595 | 3300032094 | Soil | LASQTAILPARTPPASAGMALPAFTLWWRELVRFYR |
Ga0348332_122731353 | 3300032515 | Plant Litter | VATQTATLPRSIAPASAGVLLPAFTLWWREIVRFYRQK |
Ga0335079_102580614 | 3300032783 | Soil | MATQAASLERSVAPASAGVILPAFTLWWREIVRFYR |
Ga0335081_126666601 | 3300032892 | Soil | MASTSITVNTAPSAGVVLPAFTLWWREVVRFYRQRAR |
Ga0371490_11394791 | 3300033561 | Peat Soil | MATQTATFPVTAPASAGILLPAFTLWWREVVRFYRQRAR |
⦗Top⦘ |