 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F105616 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 41 residues |
| Representative Sequence | GSDVTDVAFAREEELAQYHLTETATRVLKKAFAMDRARRAAG |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 5.00 % |
| % of genes from short scaffolds (< 2000 bps) | 1.00 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (95.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.57% β-sheet: 0.00% Coil/Unstructured: 61.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF13345 | Obsolete Pfam Family | 7.00 |
| PF08281 | Sigma70_r4_2 | 4.00 |
| PF13349 | DUF4097 | 4.00 |
| PF01255 | Prenyltransf | 4.00 |
| PF13601 | HTH_34 | 3.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 4.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 95.00 % |
| All Organisms | root | All Organisms | 5.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005764|Ga0066903_100036108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5719 | Open in IMG/M |
| 3300012202|Ga0137363_10121019 | All Organisms → cellular organisms → Bacteria | 2020 | Open in IMG/M |
| 3300012363|Ga0137390_11945782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300016750|Ga0181505_10280631 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300026315|Ga0209686_1031403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2039 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100745381 | 3300000597 | Forest Soil | AGSDVTDVAFAREDELGRFALTTAATRVLRKAFAMDRERRVAG* |
| JGI12630J15595_100295361 | 3300001545 | Forest Soil | DVTEVVFASEQELGNYNLTETATRILKKAFAMERQRRR* |
| Ga0066823_100082152 | 3300005163 | Soil | GDATDFAYAAEEELPKYEMTETAMRILRKAFAMDRARRVA* |
| Ga0066679_104833841 | 3300005176 | Soil | RAGSDVTDLAFAREEEIGKFHLTEKATSIVKKAFAMSRARASRK* |
| Ga0066388_1049203232 | 3300005332 | Tropical Forest Soil | DATDVVYVAEEDLPEYQLTEAATRVLRKAFAMDRARRSS* |
| Ga0066707_102970781 | 3300005556 | Soil | RLGGEPRAGSDATEVAFAREEELARFHLTETATRVLKKAFAMAHARQSRR* |
| Ga0070764_104391922 | 3300005712 | Soil | SDVTDVAFATEGELSQYHLTETATRVLKKAFAMAIRRGSAG* |
| Ga0066903_1000361087 | 3300005764 | Tropical Forest Soil | LAYAREDELVKFHLTAKATSVVKKAFAMSRERAAGK* |
| Ga0070766_105410351 | 3300005921 | Soil | VAASDVTHVAFAREEELDGYGLTETAARILRKAFAMERARRGAPG* |
| Ga0066696_103064571 | 3300006032 | Soil | AGSDVTDVAFAREEEFARFHLTETATRVLRKAFAMDRARRAAK* |
| Ga0070712_1013554302 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GTPVAGSDVTDVAHAREEDLGNFGLTETATRILKKAFAMARKRHDI* |
| Ga0099794_101243222 | 3300007265 | Vadose Zone Soil | GSDVTDVAFAREDQLGNYHLTETATRILKKAFAMDRARCGRS* |
| Ga0099795_101361532 | 3300007788 | Vadose Zone Soil | GGTEVAFASEEELGKYKLTETATRILRRAFAMERERRR* |
| Ga0099830_107745991 | 3300009088 | Vadose Zone Soil | PRAGGDVTEVAFAREDEFAKFHLTETATRILKKAFAMDRVRRGAG* |
| Ga0099830_113761892 | 3300009088 | Vadose Zone Soil | VTDVAFAREEELSRFHLTTTATRVLKKAFEMERARQAPK* |
| Ga0099827_104338172 | 3300009090 | Vadose Zone Soil | EPRAGGDVTEVAFAREDEFAKFHLTETATRILKKAFAMDRVRREAG* |
| Ga0099827_111934221 | 3300009090 | Vadose Zone Soil | EPRAGSDVTDVAFAREDELPQFHLTETVKRVLKKAFAMDRARQAMN* |
| Ga0116225_13652572 | 3300009524 | Peatlands Soil | GSDVTDLVYAGEDELHLYQLTETATRVLLKAFAMDRERRRGR* |
| Ga0105238_129478182 | 3300009551 | Corn Rhizosphere | RLAGTPVAGSDVTDVAHAREEDLGNFGLTETATRILKKAFAMARKRHDI* |
| Ga0116124_10075286 | 3300009634 | Peatland | SDVTDLVYAGEDELHLYQLTETATHILLKAFAMDRDRRKLR* |
| Ga0126370_108032202 | 3300010358 | Tropical Forest Soil | PGSDVTDLAFAREDELGKFQLTEAATRVLKKAFAMDRAHARNC* |
| Ga0126370_119016951 | 3300010358 | Tropical Forest Soil | VDIAYVREEELPKYQLTEAATRVLSKAFAMDRARRLAVGKQG* |
| Ga0126378_106789602 | 3300010361 | Tropical Forest Soil | TDVAFASEDELGQYKLTETATRVLQKAFAMDRARQTEKRKA* |
| Ga0126378_115397182 | 3300010361 | Tropical Forest Soil | GSDVTDVAFVREDELTKFQLTTTATRVLQKAFAMDRERRVA* |
| Ga0134121_104971531 | 3300010401 | Terrestrial Soil | DVTDVAFAGEDELDQYHLTETATRVLKRAFAMELARRFLR* |
| Ga0134123_126233722 | 3300010403 | Terrestrial Soil | GDVTDVAFAGEDELDQYHLTETATRVLKRAFAMELARRFLR* |
| Ga0126350_101443212 | 3300010880 | Boreal Forest Soil | GGDAVDVAFAREEELESFRLTETALRILRKAFAMYRSRKEKD* |
| Ga0150983_113940621 | 3300011120 | Forest Soil | VALASEEELSRFHLTETATRILNKAFAMDRARRGTA* |
| Ga0150983_163865561 | 3300011120 | Forest Soil | TDVAFAREEELSRFHLTMTATRVLKKAFAMDRARQAAK* |
| Ga0137391_107129512 | 3300011270 | Vadose Zone Soil | AFAQESELAKFKLTETATRILRKAFAMDRARRGAR* |
| Ga0137391_110059732 | 3300011270 | Vadose Zone Soil | VAFAREEELARFHLTETATRVLKKAFAMDRARRGAR* |
| Ga0137388_107145011 | 3300012189 | Vadose Zone Soil | TDVAFASEEELSRFHLTETATRVVKKAFAMDRARRAAK* |
| Ga0137388_112547411 | 3300012189 | Vadose Zone Soil | GSDVTDVAFAREEELAQYHLTETATRVLKKAFAMDRARRAAG* |
| Ga0137363_101210191 | 3300012202 | Vadose Zone Soil | PRAGGDVTEVAFAREDEFAKFHLTETATRILKKAFAMDRARRGAG* |
| Ga0137363_115844822 | 3300012202 | Vadose Zone Soil | DAVDVAYASEDELSKFQLTEAAARVLRKAFTMDRARRGISDSAS* |
| Ga0137362_108060831 | 3300012205 | Vadose Zone Soil | SDVTDVAFAREEELSRFHLTTTATRVLKKAFAMERARQAAK* |
| Ga0137379_105707732 | 3300012209 | Vadose Zone Soil | SDVTDVAFAREEELPRFHLTETATRVLKKAFAMDCARRAAK* |
| Ga0137384_106824242 | 3300012357 | Vadose Zone Soil | SDVTDVAFAREDELTRFHLTETAMRVLKKAFAMDCARRAAK* |
| Ga0137390_119457822 | 3300012363 | Vadose Zone Soil | GEPRAGGDVTEVAFAREDEFAKFHLTETATRILKKAFAMDRVRRGAG* |
| Ga0137358_105031842 | 3300012582 | Vadose Zone Soil | FAREDQLGNYHLTETATRILKKAFAMDRARCGRS* |
| Ga0137398_109360052 | 3300012683 | Vadose Zone Soil | DVTDVAFASEEELSRFHLTETATRVVKKAFAMDRARRAAK* |
| Ga0137419_104781181 | 3300012925 | Vadose Zone Soil | HAGSDVTDVAFAREDELGDYHLTETAIRILKKAFAMDRARRGRS* |
| Ga0137416_114065451 | 3300012927 | Vadose Zone Soil | HAGSDVTDVAFAREEELARFHLTETATRVLKKAFAMDRARRAAK* |
| Ga0137416_122617852 | 3300012927 | Vadose Zone Soil | DVAFAREEELSKYGLTETATRILKKAFAMDRARRAAK* |
| Ga0137404_103018341 | 3300012929 | Vadose Zone Soil | SDVTDVAFACEDELGNYHLTETATRILKRAFAMDRVRRSRS* |
| Ga0164303_114485532 | 3300012957 | Soil | MAVAESDVTEVAYAREEELGNFGLTETATRILKKAFAMDRKRKTK* |
| Ga0126369_102665792 | 3300012971 | Tropical Forest Soil | DVVYVDEEDLPKYQLTEAATRVLRKAFAMDRARRSSVRA* |
| Ga0134075_100150604 | 3300014154 | Grasslands Soil | RAGGDVTEVAFAREDEFAKFHLTETATRILKKAFAMDRARRGAG* |
| Ga0134079_100968712 | 3300014166 | Grasslands Soil | GEPRAGSDVTDLAFAREEELGKFHLTEKATSIVKKAFAMSHERASRK* |
| Ga0181535_103524312 | 3300014199 | Bog | ATDVAFAREDQLEQFHLTETATRVLRKAFAMDRERRQLS* |
| Ga0137412_111869241 | 3300015242 | Vadose Zone Soil | DVAFASEEELSRFHLTETATRVVKKAFAMERARRAPR* |
| Ga0182038_114761502 | 3300016445 | Soil | PRAGGDVTDVVFAREEELPTFQLTTAATRVLHKAFAMDRERRVAG |
| Ga0181505_102806311 | 3300016750 | Peatland | RISGEPRAGSDATDVAFAREDQLEQFHLTETATRVLRKAFVMDRERRQLS |
| Ga0187814_103516791 | 3300017932 | Freshwater Sediment | VTHVAFAREDELEKYQLTETATRVLRKAFAMDRERQKVR |
| Ga0187819_107769652 | 3300017943 | Freshwater Sediment | DVAFASEQELSKFALTETATRVLKKAFAMARARQLQK |
| Ga0187779_107051022 | 3300017959 | Tropical Peatland | TEVAYAREEEMGEYQLTETATRVLRKAFAMYRERRTFPG |
| Ga0187776_102233002 | 3300017966 | Tropical Peatland | EPRAASDVTELAFAREEELEKYHLTETATRILKKAFAMSRARRASR |
| Ga0187780_103767161 | 3300017973 | Tropical Peatland | VTDIAFAAEEELEKFHLTPAAMRVLKNAFAMDRARRKSK |
| Ga0187769_110297501 | 3300018086 | Tropical Peatland | SDVTDLVYAAEDEFHLYHLTETATRVLRKAFAMHRERCKAE |
| Ga0210403_103920142 | 3300020580 | Soil | GSDVTHVAFASEDELGQFHLTETATRVLKKAFAMDLARRSAGK |
| Ga0210395_109836232 | 3300020582 | Soil | DVAFATEDELEKYGLTETATRILRKALAMERARRVAKK |
| Ga0210385_101206452 | 3300021402 | Soil | AGSDVTDVAYATEDELVKYGLTETATRILLKAFAMDRVRRAKE |
| Ga0210397_114894131 | 3300021403 | Soil | TDVAYAREEELGKFALTETATRILRKAFAMDRVRRTGR |
| Ga0210384_108011611 | 3300021432 | Soil | AFAREEELSRFHLTTTATRVLKKAFAMDRARQAAK |
| Ga0213879_100751602 | 3300021439 | Bulk Soil | SDVTHVALATENELEKYGLTETATRILRKAFAMDRARRAGKQ |
| Ga0210390_104935582 | 3300021474 | Soil | VADVAFASEDELAQYHLTETATRVLKKAFAMARARGSVR |
| Ga0210402_112623632 | 3300021478 | Soil | TDVAFASEEELAKYKLTETATRILKKAFAMERKRRP |
| Ga0210402_112648651 | 3300021478 | Soil | VFASEDELPQYHLTETATRVLKKAFAMALGRGSVR |
| Ga0242649_10691292 | 3300022509 | Soil | VVFASEDQLWNYRLTETATRVLKKAFAMAIRRGSFR |
| Ga0224550_10059604 | 3300022873 | Soil | WAYARENELDRFQLTETALRILRKAFGMDRARRAAR |
| Ga0247680_10245032 | 3300024246 | Soil | DVAFAGEDELDQYHLTETATRVLKRAFAMELARRFLR |
| Ga0208192_10056771 | 3300025477 | Peatland | SDVTDLVYAGEDELHLYQLTETATHILLKAFAMDRDRRKLR |
| Ga0207642_107556752 | 3300025899 | Miscanthus Rhizosphere | LAGTPVAGSDVTDVAHAREEDLGNFGLTETATRILKKAFAMARKRHDI |
| Ga0209686_10314033 | 3300026315 | Soil | DVTDLAFAREGELGRFELTEKATSVLKKAFAMSRARAAGQ |
| Ga0179587_107401801 | 3300026557 | Vadose Zone Soil | VTDVAFAREEELSKYRLTETATRILKKAFAMDRARRAAK |
| Ga0208604_10305092 | 3300027090 | Forest Soil | GSDVTDVAFASEDELGQYHLTETATRILKKAFAMVLARGSVHQP |
| Ga0208199_10666731 | 3300027497 | Peatlands Soil | TDVAFAREDELARFHLTETATRVLKKAFAMDRARQAAK |
| Ga0209422_10779422 | 3300027629 | Forest Soil | TDVVFAPEEDLHRFSLTETALRILHKAFAMDRARHGGGGKS |
| Ga0209180_106171162 | 3300027846 | Vadose Zone Soil | AFAREDELARFHLTETATRVVKKAFAMDRARPAAK |
| Ga0209693_104641991 | 3300027855 | Soil | RAGSDVTDVAFAREEELGKFHLTETATRILKKAFAMDQARRERR |
| Ga0209465_106570942 | 3300027874 | Tropical Forest Soil | DALDVAFALEPELERFQLTETATRVARKAFALSRARHVSGF |
| Ga0209380_102931752 | 3300027889 | Soil | DAVDVAFAREEELESFRLTETALRILEKAFTMYRTKKETS |
| Ga0209380_106296241 | 3300027889 | Soil | VAASDVTHVAFAREEELDGYGLTETAARIPRKAFAMERARRGAPG |
| Ga0209488_103848862 | 3300027903 | Vadose Zone Soil | AGSDVTDVAFAREDELPQFHLTETVKRVLKKAFAMDRERQAMK |
| Ga0308309_113800332 | 3300028906 | Soil | DVTDVVFAGEDELRQYHLTETATRVLKKAFAMALRRGPFR |
| Ga0265770_10045493 | 3300030878 | Soil | AFASEDELALYHLTETATRVLKKAFAMARERGLLR |
| Ga0307476_104425612 | 3300031715 | Hardwood Forest Soil | DVTDVAFAREDELGNFHLTETATRVLKKAFAMALARSVTP |
| Ga0307476_105133671 | 3300031715 | Hardwood Forest Soil | LCERMGGEPRAGSDATEVVFAGEDDLRQYHLTETATRILKKAFAMALGRGSFR |
| Ga0307474_108852881 | 3300031718 | Hardwood Forest Soil | DVTDLAFAAEDELSQFNLTPTATRIFKKAFVMAAARNGAQRNSRE |
| Ga0307474_115853941 | 3300031718 | Hardwood Forest Soil | TDVAFAREEELTQFHLTETATRVLKKAFAMDRARQAAK |
| Ga0307468_1006763331 | 3300031740 | Hardwood Forest Soil | SDVTDVVFAREEELHVYKLTETATRILQKAFAMDRLRRKAASTSND |
| Ga0307475_115836381 | 3300031754 | Hardwood Forest Soil | DVTDVAFAREEELARFQLTETATRILKKAFAMDRARQAAK |
| Ga0307473_105887862 | 3300031820 | Hardwood Forest Soil | DVTDLAFAREEELPQFHLTEKATSVLKKAFAMCRARLKASGMEAE |
| Ga0318544_104394191 | 3300031880 | Soil | EPRAGSDVTDLAFALEEELGGFKLTEKATSLLKKAFAMSRARGVGQ |
| Ga0310912_110516321 | 3300031941 | Soil | VTDVAFAREDELGRFQLTTTATRVLRKAFAMDRERRVAG |
| Ga0310916_103415461 | 3300031942 | Soil | SDVTDVVFVREDELAKFQLTTAATRVLQKAFAMDRERRVA |
| Ga0306926_100522641 | 3300031954 | Soil | GSDVTDVAFAREDELSKFQLTTTATRVLQKAFAMDRERRVAG |
| Ga0318545_100846072 | 3300032042 | Soil | VTDVAFAREDELGRFALTTAATRVLRKAFAMDRERRVAG |
| Ga0306920_1012906892 | 3300032261 | Soil | SDVTDLAFAGEDDLTRFHLTETATRVLKKAFAMYRARNKRG |
| Ga0335084_100800695 | 3300033004 | Soil | GGDATDFAYAAEEELPKYEMTETAMRILRKAFAMDRARRVA |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |