NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105614

Metagenome / Metatranscriptome Family F105614

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105614
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 55 residues
Representative Sequence KERGHARDLADFLLANGLLTPADLDEARQVAADNERSGVCEMARQRLQYRPRGN
Number of Associated Samples 90
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.00 %
% of genes from short scaffolds (< 2000 bps) 95.00 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.000 % of family members)
Environment Ontology (ENVO) Unclassified
(33.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 64.81%    β-sheet: 0.00%    Coil/Unstructured: 35.19%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF04149DUF397 15.00
PF00202Aminotran_3 5.00
PF00571CBS 3.00
PF09084NMT1 3.00
PF00753Lactamase_B 3.00
PF13411MerR_1 3.00
PF00561Abhydrolase_1 3.00
PF00903Glyoxalase 2.00
PF00440TetR_N 2.00
PF13379NMT1_2 2.00
PF03793PASTA 1.00
PF03636Glyco_hydro_65N 1.00
PF08241Methyltransf_11 1.00
PF12681Glyoxalase_2 1.00
PF13560HTH_31 1.00
PF01764Lipase_3 1.00
PF04909Amidohydro_2 1.00
PF13581HATPase_c_2 1.00
PF13377Peripla_BP_3 1.00
PF13305TetR_C_33 1.00
PF04542Sigma70_r2 1.00
PF12802MarR_2 1.00
PF00311PEPcase 1.00
PF02627CMD 1.00
PF00106adh_short 1.00
PF13191AAA_16 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 3.00
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 3.00
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.00
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 1.00
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 1.00
COG1554Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamilyCarbohydrate transport and metabolism [G] 1.00
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.00
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 1.00
COG2352Phosphoenolpyruvate carboxylaseEnergy production and conversion [C] 1.00
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 1.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.00 %
UnclassifiedrootN/A21.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001084|JGI12648J13191_1004860All Organisms → cellular organisms → Bacteria1401Open in IMG/M
3300004091|Ga0062387_101512419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia539Open in IMG/M
3300005166|Ga0066674_10375558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii664Open in IMG/M
3300005187|Ga0066675_10265248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1232Open in IMG/M
3300005338|Ga0068868_100352036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → Microbacterium timonense1261Open in IMG/M
3300005436|Ga0070713_102403407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii509Open in IMG/M
3300005437|Ga0070710_10156039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1411Open in IMG/M
3300005437|Ga0070710_10210445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1232Open in IMG/M
3300005458|Ga0070681_10172716All Organisms → cellular organisms → Bacteria2083Open in IMG/M
3300005530|Ga0070679_100413564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1294Open in IMG/M
3300005546|Ga0070696_100213122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1446Open in IMG/M
3300005560|Ga0066670_10364907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii881Open in IMG/M
3300005610|Ga0070763_10098653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1470Open in IMG/M
3300005610|Ga0070763_10906343All Organisms → cellular organisms → Bacteria → Terrabacteria group525Open in IMG/M
3300005842|Ga0068858_100926211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii853Open in IMG/M
3300006175|Ga0070712_101449076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii600Open in IMG/M
3300006176|Ga0070765_100449350Not Available1207Open in IMG/M
3300006914|Ga0075436_101119738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii593Open in IMG/M
3300009521|Ga0116222_1025555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2644Open in IMG/M
3300010379|Ga0136449_102788845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300010379|Ga0136449_104151987Not Available538Open in IMG/M
3300010876|Ga0126361_10182806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba746Open in IMG/M
3300014325|Ga0163163_10979948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii909Open in IMG/M
3300014657|Ga0181522_10507124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii727Open in IMG/M
3300016270|Ga0182036_11569334All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300016387|Ga0182040_10777713All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300016387|Ga0182040_11549317All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300017932|Ga0187814_10031306All Organisms → cellular organisms → Bacteria1979Open in IMG/M
3300017955|Ga0187817_10902720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces lincolnensis565Open in IMG/M
3300017959|Ga0187779_10750589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300017970|Ga0187783_10842403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii661Open in IMG/M
3300017972|Ga0187781_10344669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1060Open in IMG/M
3300017973|Ga0187780_10331925Not Available1072Open in IMG/M
3300018007|Ga0187805_10354293Not Available678Open in IMG/M
3300018062|Ga0187784_10706580All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus807Open in IMG/M
3300018090|Ga0187770_10974693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia682Open in IMG/M
3300020082|Ga0206353_10458513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia597Open in IMG/M
3300020583|Ga0210401_10835021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii781Open in IMG/M
3300021181|Ga0210388_11045887All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300021402|Ga0210385_10037342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3180Open in IMG/M
3300021402|Ga0210385_10639472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales812Open in IMG/M
3300021407|Ga0210383_11267315All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300021433|Ga0210391_10336483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1184Open in IMG/M
3300021439|Ga0213879_10263683All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300021560|Ga0126371_13166310All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300022529|Ga0242668_1054853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii720Open in IMG/M
3300022731|Ga0224563_1028990All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300025906|Ga0207699_10189543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1387Open in IMG/M
3300025912|Ga0207707_10452239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1099Open in IMG/M
3300026374|Ga0257146_1038112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii780Open in IMG/M
3300027110|Ga0208488_1064599Not Available613Open in IMG/M
3300027158|Ga0208725_1025080All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300027676|Ga0209333_1208798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082513Open in IMG/M
3300028379|Ga0268266_10374375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1342Open in IMG/M
3300028759|Ga0302224_10323777Not Available621Open in IMG/M
3300028789|Ga0302232_10663311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae512Open in IMG/M
3300029882|Ga0311368_11056267Not Available531Open in IMG/M
3300029910|Ga0311369_11384985Not Available533Open in IMG/M
3300029951|Ga0311371_11459614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia765Open in IMG/M
3300030007|Ga0311338_10716467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → Kutzneria albida → Kutzneria albida DSM 438701009Open in IMG/M
3300030053|Ga0302177_10629327Not Available546Open in IMG/M
3300030399|Ga0311353_11341282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii585Open in IMG/M
3300031234|Ga0302325_11314777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia949Open in IMG/M
3300031525|Ga0302326_12242611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300031543|Ga0318516_10098215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1653Open in IMG/M
3300031544|Ga0318534_10208752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1127Open in IMG/M
3300031573|Ga0310915_10787124All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300031708|Ga0310686_109135047Not Available906Open in IMG/M
3300031708|Ga0310686_116183835Not Available772Open in IMG/M
3300031713|Ga0318496_10100628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1550Open in IMG/M
3300031765|Ga0318554_10444537All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300031768|Ga0318509_10278233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii936Open in IMG/M
3300031778|Ga0318498_10340348All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300031799|Ga0318565_10078661All Organisms → cellular organisms → Bacteria1565Open in IMG/M
3300031831|Ga0318564_10446909All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031835|Ga0318517_10571209All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300031879|Ga0306919_10114014Not Available1924Open in IMG/M
3300031890|Ga0306925_10724710All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300031912|Ga0306921_11138615Not Available872Open in IMG/M
3300031942|Ga0310916_10723384All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300031942|Ga0310916_11204849Not Available626Open in IMG/M
3300031946|Ga0310910_10511534Not Available953Open in IMG/M
3300031954|Ga0306926_10108331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3414Open in IMG/M
3300032001|Ga0306922_10326543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1647Open in IMG/M
3300032041|Ga0318549_10316018All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300032043|Ga0318556_10417456All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300032044|Ga0318558_10682621All Organisms → cellular organisms → Bacteria → Terrabacteria group513Open in IMG/M
3300032054|Ga0318570_10075524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1441Open in IMG/M
3300032063|Ga0318504_10268894Not Available804Open in IMG/M
3300032064|Ga0318510_10270822All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300032066|Ga0318514_10170873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1133Open in IMG/M
3300032067|Ga0318524_10453115Not Available671Open in IMG/M
3300032067|Ga0318524_10653385Not Available554Open in IMG/M
3300032076|Ga0306924_11958938All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300032160|Ga0311301_11444601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium853Open in IMG/M
3300032892|Ga0335081_10613095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1340Open in IMG/M
3300033134|Ga0335073_11405045Not Available681Open in IMG/M
3300033289|Ga0310914_10633554Not Available963Open in IMG/M
3300033289|Ga0310914_11779115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa10.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland7.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.00%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil1.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.00%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001084Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022731Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027158Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12648J13191_100486023300001084Forest SoilLAGFLLSNALLTPADLDEARKVAAENERTGVCETARQRLRYRPREA*
Ga0062387_10151241923300004091Bog Forest SoilERGHARDLADFLLANGLLTPADLDEARQTAADNERSGVCAMARQRLQYRPKGN*
Ga0066674_1037555823300005166SoilDLADFLLANGLLTPADLDEARQVAAENERKGVCEIARRRLQYRPKGRGAGA*
Ga0066675_1026524813300005187SoilRGHARDLADFLLANGLLTPADLDEARQVAAENERKGICEIARQRLQYRPKGRGAGA*
Ga0068868_10035203613300005338Miscanthus RhizosphereWKERGHARDLADFLLANGLLTPADLDEARQVAAENERTGVCEIARQRLQYRPKEK*
Ga0070713_10240340713300005436Corn, Switchgrass And Miscanthus RhizosphereERGHARDLADFLLANGLLTPADLDEARQVAAENERKGICEIARRRLQYRPKGRGAGA*
Ga0070710_1015603943300005437Corn, Switchgrass And Miscanthus RhizosphereADFLLANGLLTPADLDEARQVAAENERKGICEIARRRLQYRPKGRGAGA*
Ga0070710_1021044533300005437Corn, Switchgrass And Miscanthus RhizosphereGHARDLADFLLANGLLTPADLDEARQVAAENERTGVCEIARQRLQYRPREK*
Ga0070681_1017271643300005458Corn RhizosphereLQGMIWSERGHARDLADFLLSHALLTPADLDEARRAVADNERRGICDQARQRLQYRPRGN
Ga0070679_10041356413300005530Corn RhizosphereDLADFLLSHALLTPADLDEARRAVADNERRGICDQARQRLQYRPRGN*
Ga0070696_10021312233300005546Corn, Switchgrass And Miscanthus RhizosphereRDLADFLLANGLLTPADLDEARQVAAENERTGVCEIARRRLQYRPKGKDA*
Ga0066670_1036490713300005560SoilARDLADFLLANGLLTPADLDEARQVAAENERKGVCEIARRRLQYRPKGKGAGA*
Ga0070763_1009865333300005610SoilERGHARDLADFLLANGLLTPADLDDARQTAAENERSGVCEMARQRLQYRPKDT*
Ga0070763_1090634313300005610SoilRDLADFLLANGLLTSADLDEARQTAADNERSGVCEMARRRLQYRPKGN*
Ga0068858_10092621133300005842Switchgrass RhizosphereKERGHARDLADFLLANGLLTPADLDEARQVAAENERTGVCEIARQRLQYRPKEK*
Ga0070712_10144907613300006175Corn, Switchgrass And Miscanthus RhizosphereRDLADFLLANGLLTPADLDEARRVAAENERKGVREIARQRLQYRPKGKGNGA*
Ga0070765_10044935013300006176SoilADFLLSNALLTPADLDEARKVAAENERTGVCETARQRLRYRPREA*
Ga0075436_10111973823300006914Populus RhizosphereRDLADFLLANGLLTPADLDEARQVATENERAGVCEIARRRLQYRPKGKDA*
Ga0116222_102555513300009521Peatlands SoilQGFIWKERGHARDLADFLLANGLLTPADLDDARQIAAENERNGVCEMARQRLQYRPRGT*
Ga0136449_10278884513300010379Peatlands SoilRGHARDLADFLLANGLLTPADLDEARQAAAENERNGVCAMARQRLQYRPKGT*
Ga0136449_10415198713300010379Peatlands SoilRGHARDLADFLLANGLLTPADLDEARQAAAENERNGVCAMARQRLQYRPKGN*
Ga0126361_1018280633300010876Boreal Forest SoilLQGLIWSERGHARDLADFLLANGLLTPADLDEARQAATDNERSGVCEMARQRLQYRPRGT
Ga0163163_1097994813300014325Switchgrass RhizosphereDLADFLLANGLLTPADLDEARQVATENERAGVCEIARRRLQYRPKGKDA*
Ga0181522_1050712413300014657BogERGHTRELADFLLANGLLTPADLDEARQAAADNERSGVCEMARQRLQYRPRGN*
Ga0182036_1156933423300016270SoilLQSLIWKERGHARDLADFLLANGLLTPADLDQARQAAAENERNGVCAMARQRLQYRPKGS
Ga0182040_1077771313300016387SoilRGHARGLADFLLANGLLTPADLDEARQVAADNERTGVCEIARQRLQYRPRGD
Ga0182040_1154931713300016387SoilVSDYKKLLQGLIWKERGHARGLADFLLANGLLTPADLDEARQAAADNERSGVCEMARQRLQYRPKSN
Ga0187814_1003130613300017932Freshwater SedimentIWKERGHARDLADFLLANGLLTPADLDEARQAAADNERNGVCERARQRLQYRPRGN
Ga0187817_1090272023300017955Freshwater SedimentQGFIWKERGHARDLADFLLANGLLTPADLDEARQAAAENERSGVCAMARQRLQYRPKGN
Ga0187779_1075058923300017959Tropical PeatlandYKKLLQSLIWKERGHARDLADFMLANGLLTPADVDEARQAAADNERSGVCEMARQRLQYRPRGN
Ga0187783_1027698523300017970Tropical PeatlandIWKERGHARDLGDFLLSHALLTPADLDEARRIAAGNERSGVCERARQRLRYRPKGT
Ga0187783_1084240313300017970Tropical PeatlandLLQGLIWSERGHARDLADFLLANGLLTPADLDEARQAAADNERNGVCEMARQRLQYRPRG
Ga0187781_1034466923300017972Tropical PeatlandLQGLIWKERGHARDLADFLLANGLLTPADLDEARHVAADNERSGVCEMARQRLQYRPRGN
Ga0187780_1033192523300017973Tropical PeatlandLLQGFIWKERGHARDLADFLLANGLLTQADLDEARQIAAENERNGVCEMARQRLQYRPKD
Ga0187805_1035429323300018007Freshwater SedimentGFIWKERGHARDLADFLLANGLLTPADLDDARQIAAENERNGVCEMARQRLQYRPRGT
Ga0187784_1070658023300018062Tropical PeatlandQGLIWKERGHARDLADFLLANGLLTPADLDEARHVAADNERSGVCEMARQRLQYRPRGN
Ga0187770_1097469313300018090Tropical PeatlandERGHARDLADYLLANGLLTPADLDEARQVAAENERNGVCAMARQRLQYRPKGN
Ga0206353_1045851323300020082Corn, Switchgrass And Miscanthus RhizosphereARDLADFLLSHALLTPADLDEARRAVADNERRGICDQARQRLQYRPRGN
Ga0210401_1083502113300020583SoilHARDLADFLLANGLLTPADLDEARQVAAENERKGVCEIARRRLQYRPKGKGAGA
Ga0210388_1104588723300021181SoilDLADFLLSNALLTPADLDQARQVAVDNERTGVCETARQRLRYRPREA
Ga0210385_1003734213300021402SoilLADFLLSNALLTPADLDEARKVAAENERTGVCETARQRLRYRPREA
Ga0210385_1063947213300021402SoilFIWKERGHARDLADFLLANGLLTPADLDEARQAAADNERSGVCAMARQRLQYRQKDN
Ga0210383_1126731513300021407SoilWSERGHARDLADFLLTSGLLTPADLDEARQAAADNERSGVCEMARQRLQYRPRGN
Ga0210391_1033648333300021433SoilKERGHARDLADFLLANGLLTPADLDEARQAAADNERSGVCAMARQRLQYRQKDN
Ga0213879_1026368313300021439Bulk SoilDLADFLLSNALLTPADLDQARQAAADNERSGVCEAARQRLRYRPREA
Ga0126371_1316631023300021560Tropical Forest SoilGRDLADFLLGNGLLTPADLDKARQVAADNERTGVCEMARQRLQYRPRGD
Ga0242668_105485313300022529SoilRDLADFLLANGLLTPADLDEARQVAAENERKGVCEIARRRLQYRPKGKGAGA
Ga0224563_102899023300022731SoilIWKERGHARDLADFLLSNALLTPADLDEARKVAAENERTGVCETARERLRYRPREA
Ga0207699_1018954313300025906Corn, Switchgrass And Miscanthus RhizosphereGHARDLADFLLANGLLTPADLDEARQVAAENERTGVCEIARQRLQYRPKEK
Ga0207707_1045223933300025912Corn RhizosphereKLLQGMIWSERGHARDLADFLLSHALLTPADLDEARRAVADNERRGICDQARQRLQYRPRGN
Ga0257146_103811223300026374SoilERGHARDLADFLLANGLLTPADLDEARQVAAENERKGICEIARQRLQYRPKGKGAGA
Ga0208488_106459913300027110Forest SoilDLADFLLANGLLTPADLDEARQLAADNERSGVCEMARQRLQYRPKGN
Ga0208725_102508023300027158Forest SoilWKERGHARDLADFLLSNALLTPADLDEARKVAAENERTGVCETARQRLRYRPREA
Ga0209333_120879823300027676Forest SoilLLQGFIWKERGHARDLADFLLTNGLLTPADLDDARQAAAENERNGVCEMARQRLQYRPKD
Ga0268266_1037437533300028379Switchgrass RhizosphereARDLADFLLANGLLTPADLDEARQVAAENERTGVCEIARQRLQYRPKEK
Ga0302224_1032377713300028759PalsaKPLQGLVWSERGHARDLADFLLANGLLTPADLDEARQAAADNERNGVCEMARQRLQYRPRST
Ga0302232_1066331123300028789PalsaISSADLQGFIWSERGHTRDLAGFLLANGLLTPADLDEARQVAADNERSGVCEMARQRLQYRPR
Ga0311368_1105626713300029882PalsaLIWSERGHARDLADFLLANGLLTPADLDEARQTAADNERSGVCEMARQRLQYRPRGN
Ga0311369_1138498513300029910PalsaKLLQGLVWSERGHARDLADFLLANGLLTPADLDEARQAAADNERNGVCEMARQRLQYRPRST
Ga0311371_1145961413300029951PalsaLQGLVWSERGHARDLADFLLANGLLTPADLDEARQAAADNERNGVCEMARQRLQYRPRST
Ga0311338_1071646733300030007PalsaDYKKLLQGLVWSERGHARDLADFLLANDLLTPADLDEARQTAADNERNGVCEMARQRLQYRPRGT
Ga0302177_1062932713300030053PalsaYKKLLQGLVWSERGHARDLADFLLANDLLTPADLDEARQTAADNERNGVCEMARQRLQYRPRGT
Ga0311353_1134128223300030399PalsaLADFLLANGLLTPADLDEARQAAADNERSGVCEMARQRLQYRPRGN
Ga0302325_1131477723300031234PalsaRGHTRELADFLLANGLLTPSDLDEARQAAADNERSGVCEMARQRLQYRPRGN
Ga0302326_1224261113300031525PalsaSERGHARDLAGFLLANGLLTPADLDEAKRVAADNERSGVCEMARQRLQYRPKGSGA
Ga0318516_1009821533300031543SoilFIWKERGHARDLADFLLSHALLTPADLDEARRVAAENERSGVCERARQRLRYRPKGT
Ga0318534_1020875213300031544SoilLQGLIWSERGHARDLADFLLANGLLTPADLDEARHVAADNERSGVCEMARQRLQYRPRGN
Ga0310915_1078712423300031573SoilGLIWKERGHARGLADFLLANGLLTPADLDEARQAAADNERSGVCEMARQRLQYRPKSN
Ga0310686_10913504713300031708SoilDFLLANGLLTPADLDEARQAAADNERSGVCAMARQRLQYRQKDN
Ga0310686_11618383513300031708SoilIWSERGHARDLADFLLTSGLLTPADLDQARQAAADNERSGVCEMARQRLQYRPRGN
Ga0318496_1010062813300031713SoilLLQGLIWKERGHARDLADFLLANGLLTPADLDEARQAAAENERNGVCAMARRRLQYRPKG
Ga0318554_1044453723300031765SoilKERGHARDLADFLLANGLLTSADLDEARQAAADNERSGVCEMARQRLQYRPRGN
Ga0318509_1027823333300031768SoilWQERGHARDLAGFLLGNGLLTPADLDEARHVASENERAGICAQARLRLKYRPKET
Ga0318498_1034034813300031778SoilHARDLADFLLANGLLTPADLDEARHVAADNERSGVCEMARQRLQYRPRGN
Ga0318565_1007866123300031799SoilKKLLQGLIWKERGHARDLADFLLANVLLTSADLDEARQAAADNERSGVCEMARQRLQYRPRGN
Ga0318564_1044690923300031831SoilKLLQGLIWKERGHARDLADFLLANGLLTPADLDEARQAAADNERSGVCEMARQRLQYRPKSN
Ga0318517_1057120923300031835SoilLADFLLANGLLTPADLDEARQAAADNERSGVCEMARQRLQYRPKSN
Ga0306919_1011401413300031879SoilLADFLLSHALLTPADLDEARRIAADNERSGVCEQARQRLRYRPKGT
Ga0306925_1072471013300031890SoilDLADFLLANGLLTPADLDEARQAAADNERSGVCEMARQRLQYRPKSN
Ga0306921_1113861523300031912SoilRDLADFLLANGLLTPADLDEARQAAADNERSGVCEMARQRLQYRPKSN
Ga0310916_1072338413300031942SoilWKERGHARDLADFLLANGLLTSADLDEARQAAADNERSGVCEMARQRLQYRPRGN
Ga0310916_1120484913300031942SoilKERGHARDLADFLLANGLLTPADLDEARQVAADNERSGVCEMARQRLQYRPRGN
Ga0310910_1051153423300031946SoilQGLIWKERGHARDLADFLLANGLLTPADLDEARQVAADNERSGVCEMARQRLQYRPRGN
Ga0306926_1010833133300031954SoilGLIWKERGHARDLADFLLANGLLTPADLDEARQVAADNERSGVCEMARQRLQYRPRGN
Ga0306922_1032654313300032001SoilQGFIWQERGHARDLAGFLLGNGLLTPADLDEARHVASENERAGICAQARLRLKYRPKET
Ga0318549_1031601823300032041SoilIWKERGHARDLADFLLANVLLTSADLDEARQAAADNERSGVCEMARQRLQYRPRGN
Ga0318556_1041745613300032043SoilWKERGHARGLADFLLANGLLTPADLDEARQAAADNERSGVCEMARQRLQYRPKSN
Ga0318558_1068262113300032044SoilLIWKERGHARDLADFLLANGLLTPADLDEARQAAADNERSGVCEMARQRLQYRPKSN
Ga0318570_1007552413300032054SoilYKKLLQGLIWSERGHARDLADFLLANGLLTPADLDEARHVAADNERSGVCEMARQRLQYRPRGN
Ga0318504_1026889413300032063SoilERGHARDLADFLLSHALLTPADLDEARRVAAENERSGVCERARQRLRYRPKGT
Ga0318510_1027082213300032064SoilLQGLIWKERGHARDLADFLLANGLLTSADLDEARQAAADNERSGVCEMARQRLQYRPRGN
Ga0318514_1017087333300032066SoilKKLLQGLIWSERGHARDLADFLLANGLLTPADLDEARHVAADNERSGVCEMARQRLQYRPRGN
Ga0318524_1045311523300032067SoilIWKERGHARDLADFLLSHALLTPADLDEARQIAAGNERSGVCERARQRLRYRPKGT
Ga0318524_1065338523300032067SoilIWKERGHARDLADFLLANGLLTPADLDEARQVAADNERSGVCEMARQRLQYRPRGN
Ga0306924_1195893813300032076SoilSERGHARDLADFLLANGLLTPADLDEARHVAADNERSGVCEMARQRLQYRPRGN
Ga0311301_1144460123300032160Peatlands SoilFIWKERGHARDLADFLLANGLLTAADLDEARQTAADNERHGVCEMARARLQYRPKDH
Ga0335081_1061309533300032892SoilFIWKERGHARDLADFLLANGLLTSADVDEARQVAAENERNGVCAMARQRLQYRPKGS
Ga0335073_1140504513300033134SoilYKKQLQGLIWSERGHARDLAGYLLSNDLLTPADLDEALRVAYHNERDGISDRARARLKYRPRE
Ga0310914_1063355413300033289SoilARDLADFLLANGLLTPADLDEARQVAADNERSGVCEMARQRLQYRPRGN
Ga0310914_1177911523300033289SoilKLLQGLIWKERGHARDLADFLLANGLLTSADLDEARAAAADNERSGVCEMARQRLQYRPKGN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.