| Basic Information | |
|---|---|
| Family ID | F105608 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 43 residues |
| Representative Sequence | EGYLAIAKREPGRVVVVDARGTPGQTHERIVEVVRRKLRL |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 1.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.29% β-sheet: 0.00% Coil/Unstructured: 64.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF13177 | DNA_pol3_delta2 | 62.00 |
| PF13787 | HXXEE | 5.00 |
| PF04014 | MazE_antitoxin | 5.00 |
| PF02954 | HTH_8 | 3.00 |
| PF00753 | Lactamase_B | 3.00 |
| PF13620 | CarboxypepD_reg | 2.00 |
| PF02254 | TrkA_N | 1.00 |
| PF13440 | Polysacc_synt_3 | 1.00 |
| PF02321 | OEP | 1.00 |
| PF05222 | AlaDh_PNT_N | 1.00 |
| PF17209 | Hfq | 1.00 |
| PF00581 | Rhodanese | 1.00 |
| PF01556 | DnaJ_C | 1.00 |
| PF16694 | Cytochrome_P460 | 1.00 |
| PF03309 | Pan_kinase | 1.00 |
| PF00496 | SBP_bac_5 | 1.00 |
| PF02237 | BPL_C | 1.00 |
| PF02633 | Creatininase | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
| COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 1.00 |
| COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 1.00 |
| COG1521 | Pantothenate kinase type III | Coenzyme transport and metabolism [H] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.00 % |
| All Organisms | root | All Organisms | 1.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005538|Ga0070731_10000909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 34102 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.00% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.00% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1049738381 | 3300000955 | Soil | ETRAFFGRVHDGYMAIAKREPGRVVIVDARGTPGQTHERILEIVQRRFRF* |
| JGI12635J15846_105960262 | 3300001593 | Forest Soil | FFARVHQGYLAIAAREHGRVAVVDARGTPRQTHERIVELVRQKLKL* |
| Ga0062389_1007371073 | 3300004092 | Bog Forest Soil | RVHEGYMAIAKRDHGRVVTVDARGTPGQTHARIVDVVRRKLKL* |
| Ga0062386_1011613591 | 3300004152 | Bog Forest Soil | TRAFFARVREGYHAIAKREPGRVVIVDARGTPGQTHQRIVEVVRRKLRV* |
| Ga0066672_107217611 | 3300005167 | Soil | VRDGYLAIAKREHARVAIVNASGSPAQTHRQIIEVVTRKLKLTEK* |
| Ga0070682_1008087762 | 3300005337 | Corn Rhizosphere | ETGAFFARVREGFAAIAKREPTRVVTVDARGTPAQTHAKITDVVRRKFKL* |
| Ga0066687_108213502 | 3300005454 | Soil | RNGYLAIARRETGRVVVVDARGTPSQTHAKILDVVKQKLRLNSRG* |
| Ga0070731_100009091 | 3300005538 | Surface Soil | FFARVHQGYSAIAKRERRRVVRVDASGTPVQTHQAILETVKRKLSITLRS* |
| Ga0070733_110281661 | 3300005541 | Surface Soil | GYQAIAAREPQRVVAVDASGTPGQTHRRILDVVGRKVKPAASKL* |
| Ga0070732_103653361 | 3300005542 | Surface Soil | EQETRTFFARVRDGYAFIAKREPGRVVTVDARGTPAQTHQRIVELVRKKLRI* |
| Ga0066661_102895352 | 3300005554 | Soil | RAFFVRVHEGYLAIAAREHGRVAVVDARGTPGQTHQRIVEIVRRKLKL* |
| Ga0066703_106295861 | 3300005568 | Soil | GYLAIARRETGRVVVVDARGTPSQTHAKILDVVKQKLRLNSRG* |
| Ga0070762_100156344 | 3300005602 | Soil | VRSTYLAIAKREPQRVIVVDARGTPGETHKQIVEVVGRKLKF* |
| Ga0070763_103472451 | 3300005610 | Soil | RVHEGYVAIAKREHARVTVVDARGTPGQTHTRIVEVVRRKLKL* |
| Ga0066788_100988113 | 3300005944 | Soil | REGYLAIAAREKGRVVMVDARGTPGQTHAKIVEVVRRKLKA* |
| Ga0070717_117684432 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SFFARVHEGYLTIAKREHARVVLVDARGTPTQTHSRVVDIVRHKLKLV* |
| Ga0075028_1003034561 | 3300006050 | Watersheds | AYLAIAIREPQRMVVVDARGTPSETHRQIVDVVRRKLKLVAKTA* |
| Ga0070712_1018696251 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | RREPERVVLVDARGTPSQTHAKIVDVVQRKLRLKNDS* |
| Ga0070765_1005279782 | 3300006176 | Soil | FGRVRSAYLAIAKREPQRMVVVDARGTPEQTHKQITDVVRRKLKLSAKTA* |
| Ga0066665_112667421 | 3300006796 | Soil | RVREGYLAIAKREPHRVALVDASGTPGQTHAQITDVVKRRLKLNP* |
| Ga0116222_12258502 | 3300009521 | Peatlands Soil | HEGYLAIAAREHGRVAVVDARGTPAQTHQRIVEIVRKKLKM* |
| Ga0116219_101138031 | 3300009824 | Peatlands Soil | AIAKREPGRVAVVDARGTPGQTHQRIVEIVRRKLKLAL* |
| Ga0126373_101904801 | 3300010048 | Tropical Forest Soil | AIARREVDRVAVIDAGGTPSQTHAKILEVVLRKLRLTARTA* |
| Ga0134084_102368742 | 3300010322 | Grasslands Soil | FFARVREGFAAIAKREPTRVVTVDARGTPAQTHAKITDVVRRKFKL* |
| Ga0126370_105031741 | 3300010358 | Tropical Forest Soil | IARREPGRVVVVDARGTPGQTHQKILEVVRRKIRL* |
| Ga0126372_108926342 | 3300010360 | Tropical Forest Soil | AIAKRESDRVAVVDARGTPAQTHVKILEVVLRRLRLGLKPS* |
| Ga0134124_116034311 | 3300010397 | Terrestrial Soil | ARRETGRVALVDARGTPLQTHERIMDVVRQKLKLGK* |
| Ga0137776_18251321 | 3300010937 | Sediment | TRAFFGRVREGFAVIAKREPGRVVVVDARGTPGQTHQKILEVVRRKVKL* |
| Ga0137392_114480162 | 3300011269 | Vadose Zone Soil | QETRAFFVRVHEGYLAIAARDHGRVAVVDARGTPGQTHQRVVEVVRRKLKLA* |
| Ga0137393_112866511 | 3300011271 | Vadose Zone Soil | PFFSRVRDGYLAIAKREPTRVAIVNASGTPAQTHRQIMEVVTRKLKLTEK* |
| Ga0137388_110798671 | 3300012189 | Vadose Zone Soil | RAFFARVHEGYLAIAARDRARIAVVNARGTPGQTHQKIVELVRSKLKF* |
| Ga0137372_100640704 | 3300012350 | Vadose Zone Soil | VHEGYLAIAKRDHGRGAVVDARGTPGQTHQKIVEVVRRKLKL* |
| Ga0150984_1198109321 | 3300012469 | Avena Fatua Rhizosphere | RVREGYLAIAKREAGRVVLVDARGTPAQTHQKILELVRRKFRI* |
| Ga0137410_106465331 | 3300012944 | Vadose Zone Soil | GYLAIAKREAGRVALIDARGTPSQTHAKILDVVLRRLRLGTKTH* |
| Ga0164307_110403912 | 3300012987 | Soil | VREGFAAIAKREPARVITVDARGTPAQTHAKIMDVVRRKFKL* |
| Ga0157378_122535411 | 3300013297 | Miscanthus Rhizosphere | GFAAIAKREPARVVVVDARGTAGQTHQKILEVVRRKLKV* |
| Ga0157372_100041391 | 3300013307 | Corn Rhizosphere | EGFAAIAKREPARVVTVDARGTPTQTHVRIMEVVRRKFKL* |
| Ga0181518_104397752 | 3300014156 | Bog | VREGYLAIAQREPGRVVTVDAQGTPRQTHQRILEAVQKKLRL* |
| Ga0181531_100805693 | 3300014169 | Bog | AIAKREHGRVVVVDARGTPGQTHARIVEVVRKRLKL* |
| Ga0137418_110815761 | 3300015241 | Vadose Zone Soil | AIAKREPHRVSVVDAQGTPAQTHQRIMEVVARKLKLTT* |
| Ga0187820_10856572 | 3300017924 | Freshwater Sediment | AIAKREPGRVVMVDARGTPGQTHARIREVVQKKLKM |
| Ga0187819_106371001 | 3300017943 | Freshwater Sediment | EPQRVVVVDARGTPEETHRQIMDVVRRKLRLAARTA |
| Ga0187817_111172372 | 3300017955 | Freshwater Sediment | VHEGYLAIAKRETHRVVMVDARGTPAQTHQRIMEVVGRKLKLTRDG |
| Ga0187883_101323201 | 3300018037 | Peatland | QETRAFFARVHEGYLAIAKREHGRVVTIDARGTPGQTHARIVDLVRRKLKL |
| Ga0187871_103859232 | 3300018042 | Peatland | DGYTAIANRDHARVTVVDARGTPGQTHARIVEVVRRKLKL |
| Ga0187770_105234331 | 3300018090 | Tropical Peatland | VREGYLAIATREPGRVVVVDARGTPAQTHERILEVVRRKLKL |
| Ga0187770_107500121 | 3300018090 | Tropical Peatland | TYLAIAEREPKRVAVVDARGAPEKTHQQIMEIVSKRLKLAAGMQK |
| Ga0066662_102969032 | 3300018468 | Grasslands Soil | LAIARRETGRVVVVDARGTPSQTHAKILDVVKQKLRLNSRG |
| Ga0193726_11268742 | 3300020021 | Soil | EGYLAIAVRDHGRVAVVDARGTPGQTHRKIVEVVRRKLKL |
| Ga0210408_108751042 | 3300021178 | Soil | IARRETGRVVVVDARGTPSQTHAKILDVVKQKLRLNSRG |
| Ga0210385_107612182 | 3300021402 | Soil | QNRAFFARVRDGYKAIAERDPGRVVVVDASGTPAETHGRILNVVRMKLN |
| Ga0210389_102347121 | 3300021404 | Soil | ASAKRDHGRVAVVDARGTPGQTHERIVELVRRKLKL |
| Ga0210386_102176921 | 3300021406 | Soil | AFFARVRDGYMALAKRETGRIVMIDARGTPGQTHGKIVEVVRRKLKV |
| Ga0210386_107879702 | 3300021406 | Soil | LAIAKREPQRVLVVDARGTPEQTRKQIAEVVRQKLKLSAKTA |
| Ga0210391_102632441 | 3300021433 | Soil | AYLAIAKREPQRVVVVDARGTPEQTHKLIAELVRRKLKLSAKTA |
| Ga0210390_111371631 | 3300021474 | Soil | VREGYMAIAKREPGRVVVIDASGTPLQTHAKIKETVLKKIRL |
| Ga0210398_105355752 | 3300021477 | Soil | QETRAFFARVHEGYVAIAKRDHARVTVVDARGTPGQTHTRIVEVVRRKLKL |
| Ga0210410_113256472 | 3300021479 | Soil | YLAIAVRERGRVAVVDARGTPRQTHERIVELVRQKLKL |
| Ga0213851_10613831 | 3300021860 | Watersheds | AFFARVREGYAAIARREHGRVVMVDARGTPAQTQQRILEVVQRKLKV |
| Ga0242665_102064352 | 3300022724 | Soil | AIARRETGRVVVVDARGTPSQTHAKILDVVKQRLRLNSRG |
| Ga0208691_10503852 | 3300025612 | Peatland | RVHEGYLAIAKREHGRVVTIDARGTPGQTHARIVDLVRRKLKL |
| Ga0207692_108307482 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LASARRETGRVVVVDARGTPSQTHAKILDVVKQKLRLNSRG |
| Ga0207693_103652821 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | EGFAAIAKREPERVVTVDARGTPAQTHGKIMDVVRRKFTL |
| Ga0207646_117681901 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AIAKREPGRVVVVDARGTPGQTHQKILEVVRKKIRV |
| Ga0207700_119599491 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ARVHEGYVAIAAREKGRVVMVDARGTPGQTHAKIVEVVRRKLKM |
| Ga0207664_103464962 | 3300025929 | Agricultural Soil | AIARREPERVVLVDARGTPSQTHAKIVDVVQRKLRLKNDS |
| Ga0207664_111821522 | 3300025929 | Agricultural Soil | RSFFGRVRDGYMAIAKREHGRVALVDARGTPGQTHQRIREVVQKKLKI |
| Ga0257154_10686571 | 3300026467 | Soil | AIAAREHGRVVVVDARGTPGQTHARIVEVVRRKLRV |
| Ga0209418_10005044 | 3300027371 | Forest Soil | GYMAIARREAARVVVVDARGTPSQTHAKIVEVVNRKLRLKMGG |
| Ga0209422_11334221 | 3300027629 | Forest Soil | QETRAFFARVREGFMAIAAREHGRVVVVDARGTPGQTHRRIVEIVHKKLKV |
| Ga0209579_102921191 | 3300027869 | Surface Soil | IAKREPGRVAVVDARGTPGQTHQKIVEIVRKKLKV |
| Ga0209624_100578921 | 3300027895 | Forest Soil | EGYLAIAKREPGRVVVVDARGTPGQTHERIVEVVRRKLRL |
| Ga0209698_100528095 | 3300027911 | Watersheds | RVREGYMSIAKREPGRVVVVDASGAPGQTHQRVMEAVRRKVRL |
| Ga0222749_103922461 | 3300029636 | Soil | IAAREHGRVAVVDARGTPGQTHARIVEIVRRKLRL |
| Ga0222749_104718062 | 3300029636 | Soil | AIAAREPERVVVLDARGTPDATHRRIVEVVRRKLRLKAALSA |
| Ga0311338_108674581 | 3300030007 | Palsa | ARVHEGYLAIAKREQGRVVVVDARGTPGQTHASIANAVRRKLKLG |
| Ga0265750_10221292 | 3300030813 | Soil | LAIAARETQRVVVVDARGTPAQTHQRIVEVVERKLKLPTTAR |
| Ga0075388_108871691 | 3300030848 | Soil | LAIAARDHARIAVINARGTPGQTHQKIVEVVRNKLKF |
| Ga0170822_160204252 | 3300031122 | Forest Soil | GYLEIAAREKGRVVMVDARGTPGQTHAKIVEIVRRKVKV |
| Ga0307499_102257601 | 3300031184 | Soil | DGYMAIAKREPGRVVIVDARGTPAQTHERILEIVQRRFRF |
| Ga0170824_1259320342 | 3300031231 | Forest Soil | VCVHEGYLAIAAREHGRVAVVDARGTPGQTHERIVEIVRRKLKV |
| Ga0302325_106688641 | 3300031234 | Palsa | GYMAIAKRENARVVVVDARGTPGQTHARLVELVRRKLKL |
| Ga0265325_101151111 | 3300031241 | Rhizosphere | YLAIAARDHGRVSVIDARGTPGQTHRKIVEVVRRKVKL |
| Ga0170820_141258463 | 3300031446 | Forest Soil | AFFVRVHEGYLTIAAREHGRVAVVDARGTPGQTHQRIVEVVRRKLKL |
| Ga0307476_104950213 | 3300031715 | Hardwood Forest Soil | GYRAIAAREPGRVAVVDARGTPVQTHERIVEVVRRKLRL |
| Ga0307476_107279151 | 3300031715 | Hardwood Forest Soil | RDGYHTIAKREPGRMVIVDARGTPGQTHQKIVEVVRKKLKL |
| Ga0307473_102857021 | 3300031820 | Hardwood Forest Soil | AIARREPERVVVIDARGTPSQTHAKVLDVVTRKLRLTGRT |
| Ga0307478_100025891 | 3300031823 | Hardwood Forest Soil | HGYMAIARREPERVVVIDARGTPSQTHAKILEAVKTRLRLPAKT |
| Ga0307478_109703551 | 3300031823 | Hardwood Forest Soil | HTIAKREPGRMVIVDARGTPGQTHQKIVEVVRKKLKL |
| Ga0307478_111187861 | 3300031823 | Hardwood Forest Soil | AIAKRETGRVVMIDARGTPGQTHGKILEVVRRKLKM |
| Ga0302315_105766582 | 3300031837 | Palsa | RAFFARVHDGYVAIAKREHGRVVTVDARGTPGQTHARIVDVVRRKLKLV |
| Ga0311301_107748782 | 3300032160 | Peatlands Soil | RVREGYMAIAKREPGRVAVVDARGTPGQTHQRIVEIVRRKLKLAL |
| Ga0307471_1003595761 | 3300032180 | Hardwood Forest Soil | AFFGRVRDGYMAIARREPGRVVTVDARGTPGQTHERIVEIVQRRFKL |
| Ga0307472_1002467482 | 3300032205 | Hardwood Forest Soil | VRNGYLAIAKREAGRVTLIDARGTPAQTHAKILDVVVRRLRLAMKPH |
| Ga0335082_101595351 | 3300032782 | Soil | RDGFAAIAKREPGRVVVVDARGTPGQTHAKILEVVHRRLKV |
| Ga0335079_116591951 | 3300032783 | Soil | RAFFGRVREGFAAIAKREPGRVVVVDARGTPGQTHQKILEIVRRKVRV |
| Ga0335069_114610412 | 3300032893 | Soil | YAAIAKREPGRVVVVDARGTPGQTHAAIREVVRKKLKL |
| Ga0335076_104109142 | 3300032955 | Soil | TRAFFTRVREGYSAIAKREPGRVVTVDARGTPAQTHQKIREMVQRKLKI |
| Ga0334790_036906_1829_1945 | 3300033887 | Soil | YLAIAKREPGRVAIVDARGTPGQTHERIAELVRKKMRL |
| Ga0370515_0450276_93_233 | 3300034163 | Untreated Peat Soil | MREGYEAIAAREPQRVVAVDARGTPGQTHRRIVEVLGRKMRLGKMP |
| ⦗Top⦘ |