| Basic Information | |
|---|---|
| Family ID | F105579 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MRHRIGIVLAVIMAGALFFPGAWGYLRLLRLPAPADQLSNLPAGGG |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (56.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (48.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 43.24% β-sheet: 0.00% Coil/Unstructured: 56.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00534 | Glycos_transf_1 | 9.00 |
| PF07080 | DUF1348 | 7.00 |
| PF00696 | AA_kinase | 6.00 |
| PF02687 | FtsX | 4.00 |
| PF00106 | adh_short | 3.00 |
| PF13692 | Glyco_trans_1_4 | 3.00 |
| PF09594 | GT87 | 3.00 |
| PF01717 | Meth_synt_2 | 2.00 |
| PF00141 | peroxidase | 2.00 |
| PF13524 | Glyco_trans_1_2 | 2.00 |
| PF09983 | DUF2220 | 2.00 |
| PF01593 | Amino_oxidase | 2.00 |
| PF13439 | Glyco_transf_4 | 2.00 |
| PF08281 | Sigma70_r4_2 | 2.00 |
| PF00196 | GerE | 2.00 |
| PF00582 | Usp | 2.00 |
| PF02604 | PhdYeFM_antitox | 2.00 |
| PF05016 | ParE_toxin | 1.00 |
| PF12902 | Ferritin-like | 1.00 |
| PF13305 | TetR_C_33 | 1.00 |
| PF00271 | Helicase_C | 1.00 |
| PF13271 | DUF4062 | 1.00 |
| PF12681 | Glyoxalase_2 | 1.00 |
| PF13683 | rve_3 | 1.00 |
| PF00069 | Pkinase | 1.00 |
| PF01425 | Amidase | 1.00 |
| PF13411 | MerR_1 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG3558 | Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamily | Function unknown [S] | 7.00 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.00 |
| COG0376 | Catalase (peroxidase I) | Inorganic ion transport and metabolism [P] | 2.00 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 2.00 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 2.00 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 2.00 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.00 % |
| Unclassified | root | N/A | 22.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005363|Ga0008090_14804535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300005468|Ga0070707_100350057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1435 | Open in IMG/M |
| 3300005468|Ga0070707_101888786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 564 | Open in IMG/M |
| 3300005602|Ga0070762_10207848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1200 | Open in IMG/M |
| 3300005610|Ga0070763_10247812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 964 | Open in IMG/M |
| 3300006028|Ga0070717_10125200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 2206 | Open in IMG/M |
| 3300006102|Ga0075015_100827076 | Not Available | 557 | Open in IMG/M |
| 3300006176|Ga0070765_100394974 | Not Available | 1290 | Open in IMG/M |
| 3300009098|Ga0105245_13163893 | Not Available | 510 | Open in IMG/M |
| 3300010362|Ga0126377_13395515 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010376|Ga0126381_102972336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 674 | Open in IMG/M |
| 3300010876|Ga0126361_11263851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300011270|Ga0137391_11188069 | Not Available | 610 | Open in IMG/M |
| 3300012349|Ga0137387_10374071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1032 | Open in IMG/M |
| 3300012359|Ga0137385_10819027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → unclassified Geodermatophilus → Geodermatophilus sp. DSM 45219 | 773 | Open in IMG/M |
| 3300012362|Ga0137361_11096245 | Not Available | 717 | Open in IMG/M |
| 3300012975|Ga0134110_10626984 | Not Available | 502 | Open in IMG/M |
| 3300016445|Ga0182038_11256329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 661 | Open in IMG/M |
| 3300017924|Ga0187820_1267784 | Not Available | 554 | Open in IMG/M |
| 3300017928|Ga0187806_1106670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 898 | Open in IMG/M |
| 3300017928|Ga0187806_1153403 | Not Available | 761 | Open in IMG/M |
| 3300017932|Ga0187814_10228527 | Not Available | 702 | Open in IMG/M |
| 3300017942|Ga0187808_10276371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
| 3300017955|Ga0187817_10975402 | Not Available | 543 | Open in IMG/M |
| 3300017959|Ga0187779_10408016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 887 | Open in IMG/M |
| 3300017973|Ga0187780_10212106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1351 | Open in IMG/M |
| 3300018007|Ga0187805_10639409 | Not Available | 504 | Open in IMG/M |
| 3300020581|Ga0210399_10224433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1565 | Open in IMG/M |
| 3300020581|Ga0210399_10368952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1198 | Open in IMG/M |
| 3300020581|Ga0210399_11312772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300020583|Ga0210401_10927556 | Not Available | 729 | Open in IMG/M |
| 3300021171|Ga0210405_10050512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3292 | Open in IMG/M |
| 3300021171|Ga0210405_10974939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300021180|Ga0210396_10385304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1233 | Open in IMG/M |
| 3300021374|Ga0213881_10034144 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
| 3300021474|Ga0210390_10519207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1002 | Open in IMG/M |
| 3300021476|Ga0187846_10030599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2446 | Open in IMG/M |
| 3300021477|Ga0210398_10933358 | Not Available | 694 | Open in IMG/M |
| 3300021479|Ga0210410_10458573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1140 | Open in IMG/M |
| 3300021860|Ga0213851_1302245 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300025922|Ga0207646_11587275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 565 | Open in IMG/M |
| 3300026551|Ga0209648_10426342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 845 | Open in IMG/M |
| 3300026999|Ga0207949_1025810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300027610|Ga0209528_1074076 | Not Available | 753 | Open in IMG/M |
| 3300027680|Ga0207826_1186581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300027908|Ga0209006_11465627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300031543|Ga0318516_10592083 | Not Available | 633 | Open in IMG/M |
| 3300031640|Ga0318555_10651147 | Not Available | 570 | Open in IMG/M |
| 3300031679|Ga0318561_10736155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300031681|Ga0318572_10429396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
| 3300031682|Ga0318560_10820226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300031713|Ga0318496_10023676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3058 | Open in IMG/M |
| 3300031713|Ga0318496_10076202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1772 | Open in IMG/M |
| 3300031713|Ga0318496_10763369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| 3300031718|Ga0307474_10671130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 818 | Open in IMG/M |
| 3300031719|Ga0306917_10675120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 812 | Open in IMG/M |
| 3300031723|Ga0318493_10123621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1319 | Open in IMG/M |
| 3300031723|Ga0318493_10244788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 957 | Open in IMG/M |
| 3300031723|Ga0318493_10450776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300031724|Ga0318500_10658156 | Not Available | 533 | Open in IMG/M |
| 3300031736|Ga0318501_10393426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
| 3300031736|Ga0318501_10714821 | Not Available | 553 | Open in IMG/M |
| 3300031751|Ga0318494_10413639 | Not Available | 783 | Open in IMG/M |
| 3300031764|Ga0318535_10218018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 854 | Open in IMG/M |
| 3300031764|Ga0318535_10219096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 852 | Open in IMG/M |
| 3300031777|Ga0318543_10075684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1418 | Open in IMG/M |
| 3300031778|Ga0318498_10019784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2839 | Open in IMG/M |
| 3300031778|Ga0318498_10368542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
| 3300031779|Ga0318566_10108396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1366 | Open in IMG/M |
| 3300031780|Ga0318508_1238935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 522 | Open in IMG/M |
| 3300031792|Ga0318529_10582863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300031798|Ga0318523_10398133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 684 | Open in IMG/M |
| 3300031805|Ga0318497_10023739 | All Organisms → cellular organisms → Bacteria | 3007 | Open in IMG/M |
| 3300031819|Ga0318568_10850798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300031821|Ga0318567_10116976 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300031845|Ga0318511_10324104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 699 | Open in IMG/M |
| 3300031846|Ga0318512_10156813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1100 | Open in IMG/M |
| 3300031860|Ga0318495_10273912 | Not Available | 753 | Open in IMG/M |
| 3300031879|Ga0306919_10740142 | Not Available | 757 | Open in IMG/M |
| 3300031890|Ga0306925_10154230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2472 | Open in IMG/M |
| 3300031894|Ga0318522_10059606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1364 | Open in IMG/M |
| 3300031896|Ga0318551_10387294 | Not Available | 794 | Open in IMG/M |
| 3300031896|Ga0318551_10636599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
| 3300031897|Ga0318520_10697020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
| 3300031910|Ga0306923_11600806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300031942|Ga0310916_10157147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1881 | Open in IMG/M |
| 3300031942|Ga0310916_10823318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 781 | Open in IMG/M |
| 3300031945|Ga0310913_10898682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300031947|Ga0310909_11591435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300032008|Ga0318562_10091129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1721 | Open in IMG/M |
| 3300032039|Ga0318559_10620463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 504 | Open in IMG/M |
| 3300032060|Ga0318505_10131873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1150 | Open in IMG/M |
| 3300032064|Ga0318510_10369154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
| 3300032068|Ga0318553_10520556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 623 | Open in IMG/M |
| 3300032089|Ga0318525_10232165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 949 | Open in IMG/M |
| 3300032090|Ga0318518_10384418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 720 | Open in IMG/M |
| 3300032261|Ga0306920_100993507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1222 | Open in IMG/M |
| 3300032261|Ga0306920_102872660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300032955|Ga0335076_10252525 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
| 3300033290|Ga0318519_10523753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 56.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.00% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.00% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0008090_148045351 | 3300005363 | Tropical Rainforest Soil | MRHRIGIILAVIMTGVLFFAGTWGYLRLLRLPVPADQLSQLPA |
| Ga0070707_1003500573 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHRIGIVLAVIMTGALFFPGAWGYLRLLRLPAAAGRLAPLPAGGGSLLSDKNTLIAL |
| Ga0070707_1018887862 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHLIGIVLAIVMGGVLFFAGAWGYLRLLRLSSPAGRLSQL |
| Ga0070762_102078482 | 3300005602 | Soil | MRHRIGIVLAVVMTGVLFFPGAWGYLRLLRLPAPADQLSDLPAGGGSL |
| Ga0070763_102478121 | 3300005610 | Soil | MRHRIGIVLAVIMTGVLFFPGAWGYLRLLRLPAPADQLS |
| Ga0070717_101252001 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHLIGILLAVVMAGVLFFAGAWGYLRLTALTTPL |
| Ga0075015_1008270762 | 3300006102 | Watersheds | MRHRIGIVLAIVMAGVLFFAGSWGYLRLLRPPAPAVPLSGLPAGGGSLLSFHGVL |
| Ga0070765_1003949741 | 3300006176 | Soil | MRHRIGIVLAVIMTGVLFFPGAWGYLRLLRLPAPADQLSDLPAGGGSL |
| Ga0105245_131638932 | 3300009098 | Miscanthus Rhizosphere | MRHRIGIVLAIVMAGVLFFAGSWGYLRLLRLPAPAA |
| Ga0126377_133955151 | 3300010362 | Tropical Forest Soil | MRHRIGIILAVIMAGVLFFPGTWGYQRLLRLSAQPGQP |
| Ga0126381_1029723362 | 3300010376 | Tropical Forest Soil | MRHRIGLVLAVIMAGVLFFPGAWGYLRLLRVPAAAGQLAQLPA |
| Ga0126361_112638512 | 3300010876 | Boreal Forest Soil | MRHRIGIILAVIMTGVLFFPGAWGYLRLLRLPAPADK |
| Ga0137391_111880691 | 3300011270 | Vadose Zone Soil | MRHLIGILLAVVMAGVLFFAGAWGYLRLTALTTPLSQLPAGGGSLLSDHHMLAGL |
| Ga0137387_103740711 | 3300012349 | Vadose Zone Soil | MRHRIGIVLAIVMAGVLFFAGSWGYLRLLRLPAPA |
| Ga0137385_108190271 | 3300012359 | Vadose Zone Soil | MRHRIGIVLAVIMTGALFFPGAWGYLRLLRLPAAAGQL |
| Ga0137361_110962452 | 3300012362 | Vadose Zone Soil | MRHRIGIILAVIMTGALFFPGAWGYLRLLRLPAPP |
| Ga0134110_106269841 | 3300012975 | Grasslands Soil | MRHRIGMVLAVIMTAVLFFPGAWGYLRLLRLPAGAGQLSGLPGG |
| Ga0182038_112563292 | 3300016445 | Soil | MRHRIGLVLAVIMAGVLFFPGAWGYLRLLRMPAAAGQLAQLPAGGGSLISDH |
| Ga0187820_12677842 | 3300017924 | Freshwater Sediment | MRHRIGIILAVIMAGVLFFPGAWGYLRLLRLPALGDELSGLPAGGGSLLP |
| Ga0187806_11066703 | 3300017928 | Freshwater Sediment | MRHRIGIILAVIMAGVLFFPGAWGYLRLLRLPAPGDQLSGLPAGGG |
| Ga0187806_11534031 | 3300017928 | Freshwater Sediment | MRHRIGIILAVILAGVLFFPGAWGYLRLLRLPAPGDQLSGLPAGGGSL |
| Ga0187814_102285271 | 3300017932 | Freshwater Sediment | MRHRIGIILAVILAGVLFFPGAWGYLRLLRLPAPGDQLSGL |
| Ga0187808_102763711 | 3300017942 | Freshwater Sediment | MRHRIGIILAVIMTGVLFFPGAWGYLRLLRVPVPADQLSNLPA |
| Ga0187817_109754021 | 3300017955 | Freshwater Sediment | MRHRIGIILAVILAGVLFFPGAWGYLRLLRLPAPGDQLSGLPAGGGSLLP |
| Ga0187779_104080161 | 3300017959 | Tropical Peatland | MRHRIGIVLAVIMAGALFFPGAWGYLRLLRLPDQADQLSNLPADGGSL |
| Ga0187780_102121061 | 3300017973 | Tropical Peatland | MRHRIGIVLAVIMAGALFFPGAWGYLRLLRLPDQADQLSNL |
| Ga0187805_106394091 | 3300018007 | Freshwater Sediment | MRHRIGIILAVILAGVLFFPGAWGYLRLLRLPAPGDQLSGLPAG |
| Ga0210399_102244333 | 3300020581 | Soil | MRHRIGIVLAIVMTGVLFFAGSWGYLRLLRLPAPAAPLSGLPAGGGSLLSFHGALAAL |
| Ga0210399_103689523 | 3300020581 | Soil | MRHRIGIVLAVIMTGVLFFPGAWGYLRLLRLPAPADQLSDLPAGGGPLIS |
| Ga0210399_113127721 | 3300020581 | Soil | MRHRIGIVLAVIMTGVLFFPGAWGYLRLLRLPAPADQ |
| Ga0210401_109275562 | 3300020583 | Soil | MRHRIGIVLAVIMTGVLFFPGAWGYLRLLRLPAPADQLSDLPADGGSLISEHHVL |
| Ga0210405_100505124 | 3300021171 | Soil | MRHRIGIVLAVIMTGVLFFPGAWGYLRLLRLPARADQLSALPAG |
| Ga0210405_109749392 | 3300021171 | Soil | MRHRIGIVLAVIMTGVLFFPGAWGYLRLLRLPAPADQLSDLPAGGGSLISEHHVLL |
| Ga0210396_103853041 | 3300021180 | Soil | MRHRIGIVLAVIMTGVLFFPGAWGYLRLLRLPAPADQLSDLP |
| Ga0213881_100341441 | 3300021374 | Exposed Rock | MRHRIGMILAVIMTGVLFFPGAWGYLRLLRLPAAEGQLAQLPAG |
| Ga0210390_105192071 | 3300021474 | Soil | MRHRIGIVLAVIMTGVLFFPGAWGYLRLLRLPARADQLS |
| Ga0187846_100305991 | 3300021476 | Biofilm | MRHRIGTILAVIMSGVLFFPGAWGYLRLLRLPAPAGELSQ |
| Ga0210398_109333581 | 3300021477 | Soil | MRHRIGIVLAVIMTGVLFFPGAWGYLRLLRLPAPADQLSGLPAGG |
| Ga0210410_104585734 | 3300021479 | Soil | MRHRIGIVLAVIMTGVLFFPGAWGYLRLLRLPAPAD |
| Ga0213851_13022451 | 3300021860 | Watersheds | MRHRIGIILAIIMTGVLFFPGSWGYLRLLRVPAAADQLSGLPASG |
| Ga0207646_115872752 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHLIGIVLAIVMGGVLFFAGAWGYLRLLRLSSPAGRLSQLPADGGS |
| Ga0209648_104263421 | 3300026551 | Grasslands Soil | MRHLIGTVLGVVMAGALFFAGAWGYLRLLRVAAPAFR |
| Ga0207949_10258101 | 3300026999 | Forest Soil | MRHRIGIVLAVIMTGVLFFPGAWGYLRLLRLPAPADQLSDLPAGGGSLISEHHVLLAL |
| Ga0209528_10740761 | 3300027610 | Forest Soil | MRHRIGIVLAVIMTGVLFFPGAWGYLRLLRVPAPS |
| Ga0207826_11865812 | 3300027680 | Tropical Forest Soil | MRHRIGLVLAVIMAGVLFFPGAWGYLRLVRLPAPADQLSNLPAGG |
| Ga0209006_114656272 | 3300027908 | Forest Soil | MRHRIGIVLAVIMTAVLFFPGTWGYLRLLRLPAPADQLSGLPAGGGSLISEHH |
| Ga0318516_105920831 | 3300031543 | Soil | MRHRIGLVLAVIMAGALFFPGAWGYLRLLRLPAPADQLSNLPAGGGSLLT |
| Ga0318555_106511471 | 3300031640 | Soil | MRHRIGIVLAVIMAGVLFFPGAWGYLRLLRLPAPADQLSN |
| Ga0318561_107361552 | 3300031679 | Soil | MRHRIGLVLAVIMAGALFFPAAWGYLRLLRLPAPADQLSNLPAGGGSLLSDHHVL |
| Ga0318572_104293962 | 3300031681 | Soil | MRHRIGLVLAVIMAGALFFPAAWGYLRLLRLPAPADQLSNLPAGGGSLL |
| Ga0318560_108202261 | 3300031682 | Soil | MRHRIGIVLAVIMAGALFFPGAWGYLRLLRLPAAADQLSNLPAGGGSLLHYH |
| Ga0318496_100236761 | 3300031713 | Soil | MRHRIGIVLAVIMAGALFFPGAWGYLRLLRLPGPADQLSNLPAGGGSLL |
| Ga0318496_100762021 | 3300031713 | Soil | MRHRIGLVLAVIMAGVLFFPGAWGYLRLLRVPAAAGQLAQL |
| Ga0318496_107633692 | 3300031713 | Soil | MRHRIGIVLAIIMAGALFFPGAWGYLRLLRLPGPADQLSNLPA |
| Ga0307474_106711302 | 3300031718 | Hardwood Forest Soil | MRHRIGMILAVIMAGVLFFPGAWGYLRLLRFPAPVGQLSRLPADG |
| Ga0306917_106751202 | 3300031719 | Soil | MRHWIGVILAVIMTGVGFFAGAWGYLRLLRLPVPADQFSQLPAG |
| Ga0318493_101236211 | 3300031723 | Soil | MRHRIGIVLAAIMAGALFFPGAWGYLRLLRLPAPADQL |
| Ga0318493_102447881 | 3300031723 | Soil | MRHRIGIILAVIMTGALFFPGAWGYLRLLRLPAPADQLAHLPAGGGSLI |
| Ga0318493_104507762 | 3300031723 | Soil | MRHRIGLVLAVIMAGALFFPAAWGYLRLLRLPAPADQLSNLPAGGG |
| Ga0318500_106581561 | 3300031724 | Soil | MRHRIGIVLAVIMAGALFFPGAWGYLRLLRLPAPADQLSNLPAGGGSLLTYH |
| Ga0318501_103934262 | 3300031736 | Soil | MRHRIGLVLAVIMAGALFFPAAWGYLRLLRLPAPADQLSNLPAGGGSL |
| Ga0318501_107148212 | 3300031736 | Soil | MRHRIGIVLAVIMAGALFFAGAWGYLRLLRLPAPADQ |
| Ga0318494_104136391 | 3300031751 | Soil | MRHRIGLVLAVIMAVALFFPGAWGYLRLLRLPAPA |
| Ga0318535_102180181 | 3300031764 | Soil | MRHRIGIVLAVIMAGALFFPGAWGYLRLLRLPAPADQLSNLPAGGGSLLTYHH |
| Ga0318535_102190961 | 3300031764 | Soil | MRHRIGMVLAVIMAGVLFFPGAWGYLRLLRMPAAAGQLAQL |
| Ga0318543_100756844 | 3300031777 | Soil | MRHRIGLVLAVIMAGVLFFPGAWGYLRLLRVPAAAGQLAQLPAGGGSLISDHNVLI |
| Ga0318498_100197843 | 3300031778 | Soil | MRHQIGLVLAVLMAGVLFFAGTWGYLRLLRLPAGEGQLSQLPAGGGSLISDHHVLI |
| Ga0318498_103685422 | 3300031778 | Soil | MRHRIGLVLAVIMAGALFFPAAWGYLRLLRLPAPADQLSNLPAGGGSLLSDHH |
| Ga0318566_101083963 | 3300031779 | Soil | MRHRIGIVLAVIMAGALFFPGAWGYLRLLRLPAPADQLSNLPAGGGSLLT |
| Ga0318508_12389351 | 3300031780 | Soil | MRHRIGMVLAVIMAGVLFFPGAWGYLRLLRLPVPADQLSNLPAGGGSL |
| Ga0318529_105828631 | 3300031792 | Soil | MRHQIGIILAVIMTGVLFFAGGWGYLQLLRLPAPAD |
| Ga0318523_103981332 | 3300031798 | Soil | MRHQIGIILAVIMTGVLFFAGGWGYLQLLRLPAPADQLSQLPAGGGSLLSEN |
| Ga0318497_100237394 | 3300031805 | Soil | MRHRIGMVLAVIMAGVLFFPGAWGYLRLLRIPAAADQLARLPADGGS |
| Ga0318568_108507982 | 3300031819 | Soil | MRHRIGIILAVIMTGVLFFPGAWGYLRLLRLPAPAGQLAHLP |
| Ga0318567_101169764 | 3300031821 | Soil | MRHRIGLVLAVIMAVALFFPGAWGYLRLLRLPAPADQLSNLPAGGGSLLPYHQV |
| Ga0318511_103241042 | 3300031845 | Soil | MRHRIGFVLAVIMAGVLFFPGAWGYLRLLRLPAPADQLSN |
| Ga0318512_101568132 | 3300031846 | Soil | MRHQIGIILAVIMTGVLFFAGGWGYLQLLRLPAPADQLSQLPAGGGSLLSENNVLFA |
| Ga0318495_102739121 | 3300031860 | Soil | MRHRIGIVLAVIMAGALFFPGAWGYLRLLRLPGPA |
| Ga0306919_107401421 | 3300031879 | Soil | MRHQIGLVLAVVMAGVLFFAGTWGYLRLLRLPAAEGQLSQLPAGGGSLISDHH |
| Ga0306925_101542303 | 3300031890 | Soil | MRHQIGLVLAVVMAGVLFFAGTWGYLRLLRLPAGEGQ |
| Ga0318522_100596061 | 3300031894 | Soil | MRHRIGLVLAVIMAGVLFFPGAWGYLRLLRMPAAAGQLAQLPAGGGSLISDHN |
| Ga0318551_103872942 | 3300031896 | Soil | MRHRIGIILAVVMSGVLFFAGAWGYLRLLRLPAQGGQL |
| Ga0318551_106365992 | 3300031896 | Soil | MRHRIGLVLAVIMAGVLFFPGAWGYLRLVRLPVPADQLSN |
| Ga0318520_106970201 | 3300031897 | Soil | MRHRIGIVLAVIMAGALFFLGAWGYLRLLRLPAPADQLSNLPAGGGSLLSYHYVLLALAA |
| Ga0306923_116008061 | 3300031910 | Soil | MRHRIGIVLAVIMAGALFFAGAWGYLRLLRLPAPADQLSNLPAGGGSLLSYHHVLLA |
| Ga0310916_101571473 | 3300031942 | Soil | MRHWIGVILAVIMTGVGFFAGAWGYLRLLRLPVPADQFSQLPAGG |
| Ga0310916_108233181 | 3300031942 | Soil | MRHQIGIILAVIMTGVLFFAGGWGYLQLLRLPAPAGQLSQLP |
| Ga0310913_108986821 | 3300031945 | Soil | MRHRIGLVLAVIMAGVLFFPGAWGYLRLLRLPAPADQ |
| Ga0310909_115914352 | 3300031947 | Soil | MRHRIGLVLAVIMAGVLFFPGAWGYLRLLRVPAAAGQLAQLPAGGGSLISDHNVL |
| Ga0318562_100911294 | 3300032008 | Soil | MRHRIGIVLAVIMAGALFFLGAWGYLRLLRLPAPADQLSNL |
| Ga0318559_106204632 | 3300032039 | Soil | MRHRIGIVLAVIMAGALFFLGAWGYLRLLRLPAPADQLSNLPAGGGSLL |
| Ga0318505_101318731 | 3300032060 | Soil | MRHQIGLVLAVLMAGVLFFAGTWGYLRLLRLPAAEGQLSQLPA |
| Ga0318510_103691542 | 3300032064 | Soil | MRHRIGIVLAVIMAGALFFPGAWGYLRLLRLPGPADQLSNLPAGGGSLLTYHHVLLA |
| Ga0318553_105205561 | 3300032068 | Soil | MRHQIGLVLAVLMAGVLFFAGTWGYLRLLRLPAAEGQLSQL |
| Ga0318525_102321653 | 3300032089 | Soil | MRHRIGIVLAVIMAGALFFPGAWGYLRLLRLPAPADQLSNLPAGGG |
| Ga0318518_103844182 | 3300032090 | Soil | MRHRIGMVLAVIMAGVLFFPGAWGYLRLLRIPAAADQLARLP |
| Ga0306920_1009935071 | 3300032261 | Soil | MRHRIGLVLAVIMAGALFFPAAWGYLRLLRLPAPADQLSNL |
| Ga0306920_1028726601 | 3300032261 | Soil | MRHRIGLVLAVIMAGVLFFPGAWGYLRLLRLPAPADQLSNLPAGGGSLLSY |
| Ga0335076_102525251 | 3300032955 | Soil | MRHRIGLVLAVIMAGVLFFPGDWGYLRLLRVPAAAGQ |
| Ga0318519_105237531 | 3300033290 | Soil | MRHWIGVILAVIMTGVGFFAGAWGYLRLLRLPVPADQFSQLPAGGGSLISDNNVLLA |
| ⦗Top⦘ |