| Basic Information | |
|---|---|
| Family ID | F105557 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MARIRGADPSKQGLLRGLFTRIVYAMTKRKVGRVVMPVQLIAHH |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.22% β-sheet: 0.00% Coil/Unstructured: 52.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF09107 | SelB-wing_3 | 9.00 |
| PF00230 | MIP | 6.00 |
| PF14534 | DUF4440 | 4.00 |
| PF08669 | GCV_T_C | 3.00 |
| PF08281 | Sigma70_r4_2 | 2.00 |
| PF07681 | DoxX | 2.00 |
| PF07238 | PilZ | 2.00 |
| PF13460 | NAD_binding_10 | 2.00 |
| PF01381 | HTH_3 | 2.00 |
| PF02075 | RuvC | 2.00 |
| PF13581 | HATPase_c_2 | 1.00 |
| PF12006 | DUF3500 | 1.00 |
| PF01408 | GFO_IDH_MocA | 1.00 |
| PF03065 | Glyco_hydro_57 | 1.00 |
| PF12681 | Glyoxalase_2 | 1.00 |
| PF13450 | NAD_binding_8 | 1.00 |
| PF13424 | TPR_12 | 1.00 |
| PF14329 | DUF4386 | 1.00 |
| PF13690 | CheX | 1.00 |
| PF12838 | Fer4_7 | 1.00 |
| PF00487 | FA_desaturase | 1.00 |
| PF07690 | MFS_1 | 1.00 |
| PF13840 | ACT_7 | 1.00 |
| PF02129 | Peptidase_S15 | 1.00 |
| PF13401 | AAA_22 | 1.00 |
| PF05163 | DinB | 1.00 |
| PF01435 | Peptidase_M48 | 1.00 |
| PF13620 | CarboxypepD_reg | 1.00 |
| PF03572 | Peptidase_S41 | 1.00 |
| PF00903 | Glyoxalase | 1.00 |
| PF13020 | NOV_C | 1.00 |
| PF00775 | Dioxygenase_C | 1.00 |
| PF03551 | PadR | 1.00 |
| PF14110 | DUF4282 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 6.00 |
| COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 2.00 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 2.00 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 2.00 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 1.00 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.00 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.00 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.00 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.00 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 1.00 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.00 % |
| Unclassified | root | N/A | 6.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY01B0O53 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 2170459024|GZRSKLJ01CYJJU | Not Available | 500 | Open in IMG/M |
| 2189573001|GZR05M102J22IX | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300004477|Ga0068971_1519023 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300005178|Ga0066688_10162318 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300005184|Ga0066671_10280344 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300005332|Ga0066388_101735072 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300005435|Ga0070714_100199375 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
| 3300005436|Ga0070713_100193617 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300005437|Ga0070710_10237228 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300005467|Ga0070706_101850302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharomonospora → Saccharomonospora iraqiensis | 548 | Open in IMG/M |
| 3300005468|Ga0070707_100542816 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300005555|Ga0066692_10800092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300005557|Ga0066704_10096945 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300005557|Ga0066704_10543263 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300005586|Ga0066691_10289930 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300005598|Ga0066706_11119370 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005764|Ga0066903_102012555 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300005764|Ga0066903_104599076 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300006050|Ga0075028_100728977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300006050|Ga0075028_101009376 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300006052|Ga0075029_100107469 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300006057|Ga0075026_100996326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium vulneris | 521 | Open in IMG/M |
| 3300006059|Ga0075017_101410670 | Not Available | 548 | Open in IMG/M |
| 3300006176|Ga0070765_100969449 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300009012|Ga0066710_102598641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300009089|Ga0099828_10783614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300009090|Ga0099827_10716190 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300009090|Ga0099827_11939583 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 513 | Open in IMG/M |
| 3300010043|Ga0126380_12015455 | Not Available | 528 | Open in IMG/M |
| 3300010320|Ga0134109_10112008 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300010358|Ga0126370_12463508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010360|Ga0126372_12547018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300010361|Ga0126378_10248037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1873 | Open in IMG/M |
| 3300010376|Ga0126381_100352058 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300011269|Ga0137392_10587505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300011269|Ga0137392_10719425 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300011269|Ga0137392_10902551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300011270|Ga0137391_10768950 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300012096|Ga0137389_11222267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300012189|Ga0137388_10072247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2879 | Open in IMG/M |
| 3300012189|Ga0137388_11491397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300012202|Ga0137363_10733227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300012207|Ga0137381_10075535 | All Organisms → cellular organisms → Bacteria | 2824 | Open in IMG/M |
| 3300012207|Ga0137381_11800500 | Not Available | 501 | Open in IMG/M |
| 3300012209|Ga0137379_10501262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300012210|Ga0137378_11644882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300012361|Ga0137360_10019313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4516 | Open in IMG/M |
| 3300012363|Ga0137390_10456552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300012363|Ga0137390_11080884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300012683|Ga0137398_10137545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1575 | Open in IMG/M |
| 3300012685|Ga0137397_10564444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 847 | Open in IMG/M |
| 3300012917|Ga0137395_10941760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300012918|Ga0137396_10108825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1986 | Open in IMG/M |
| 3300012925|Ga0137419_10000754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12630 | Open in IMG/M |
| 3300012927|Ga0137416_11579860 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012929|Ga0137404_10730269 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300012960|Ga0164301_11204314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300015264|Ga0137403_10252434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1674 | Open in IMG/M |
| 3300017936|Ga0187821_10104212 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300018020|Ga0187861_10039451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2560 | Open in IMG/M |
| 3300018047|Ga0187859_10601829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300018433|Ga0066667_11132724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300020583|Ga0210401_10381357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1272 | Open in IMG/M |
| 3300021088|Ga0210404_10737740 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300021171|Ga0210405_10450866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300021404|Ga0210389_11420755 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300021432|Ga0210384_10217970 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300021560|Ga0126371_13387327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300024232|Ga0247664_1085002 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300025406|Ga0208035_1062846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300025439|Ga0208323_1057325 | Not Available | 689 | Open in IMG/M |
| 3300025453|Ga0208455_1008795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2582 | Open in IMG/M |
| 3300025496|Ga0208191_1009625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2766 | Open in IMG/M |
| 3300025899|Ga0207642_10168671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1182 | Open in IMG/M |
| 3300025922|Ga0207646_10670383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300026304|Ga0209240_1078126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1223 | Open in IMG/M |
| 3300026334|Ga0209377_1066603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1561 | Open in IMG/M |
| 3300026515|Ga0257158_1100651 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300026552|Ga0209577_10039987 | All Organisms → cellular organisms → Bacteria | 4025 | Open in IMG/M |
| 3300027671|Ga0209588_1221979 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027842|Ga0209580_10670441 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300027875|Ga0209283_10122491 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300027894|Ga0209068_10531617 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300030706|Ga0310039_10376419 | Not Available | 526 | Open in IMG/M |
| 3300031231|Ga0170824_105985504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300031763|Ga0318537_10165008 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300031768|Ga0318509_10659153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300031779|Ga0318566_10504242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300031782|Ga0318552_10321772 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S156 | 787 | Open in IMG/M |
| 3300031820|Ga0307473_11271178 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031823|Ga0307478_11139850 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300031890|Ga0306925_11499383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300031912|Ga0306921_11480026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300031942|Ga0310916_10393346 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300032025|Ga0318507_10047097 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300032052|Ga0318506_10072815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
| 3300032055|Ga0318575_10435925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300032160|Ga0311301_11061161 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300032261|Ga0306920_100156552 | All Organisms → cellular organisms → Bacteria | 3396 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.00% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_05846790 | 2170459010 | Grass Soil | MARIEGAEPRKQGSLSALLTRFVYALTKRKLGRVVMPV |
| FD1_09342540 | 2170459024 | Grass Soil | MARIRGADQVIRGFVSGLFTRIVYVMTRRKVGRVVMPVQLVAHHPSSFG |
| FD2_00240630 | 2189573001 | Grass Soil | MARIRGADPSNQGLLSGLFTRIVYVMTRRKVGRVVMPVQLV |
| Ga0068971_15190231 | 3300004477 | Peatlands Soil | MARIAGADPKRQGWLSGLWTRIVYGMTKRKLGRLIAPVQVTAHHARILWGYG |
| Ga0066688_101623182 | 3300005178 | Soil | MARIRGAEPSQQGTFGGLLTRIVYALTKRKLGRVVMPVQVTAHHPQILWGYGQ |
| Ga0066671_102803443 | 3300005184 | Soil | MARIVGANPRQQGRLSGLFTRIVYSMAKRKLGKIVAPVQITAHHPKI |
| Ga0066388_1017350722 | 3300005332 | Tropical Forest Soil | MARIEGAIPNKQGFFQGMFTRVIYALTKRKVGRVVMPAQIAAH |
| Ga0070714_1001993751 | 3300005435 | Agricultural Soil | MARIRGAKPSQRGLFGGLLTRIVYALTKRKLGRVVMPVQV |
| Ga0070713_1001936172 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MARISGAQPSQLGLFGGMLARISYALTRRKLGRVVAPVQVTAHHPPI |
| Ga0070710_102372282 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MARIRGAEPSQQGLFGGLLTRVVYTLTKRKLGRVVMPVQVT |
| Ga0070706_1018503021 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MARLRGADPGRQGWLGGVLTRVAYALTKRKVGRVVTPVQIVAHHSRILW |
| Ga0070707_1005428161 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MARVRGADPGKQGLLSGLLTHVAYALTKRKVGRVVMPVQIVAHHSRILWG |
| Ga0066692_108000922 | 3300005555 | Soil | MARIGGAEPNQQGLAQGFFTRVIYSMVKRKVGRVVMPVKIAAHHA |
| Ga0066704_100969451 | 3300005557 | Soil | MARISGADPRKKGLLSGLLIRLFYWLTKRKLGKVVMPVQITSHHPRILWG |
| Ga0066704_105432632 | 3300005557 | Soil | MARIEGADPGKQGFFRGMFTRIIYSMTKRKVGRVVMPVRIAAHH |
| Ga0066691_102899302 | 3300005586 | Soil | MARISGADPRKKGLLSGLLVRLFYWLTKRKLGKVVMPVQIT |
| Ga0066706_111193701 | 3300005598 | Soil | MARIAGADPNQQGLFHSLFTRIIYALTKRKVGRVVMPVKLAAHHAKLLWGY |
| Ga0066903_1020125551 | 3300005764 | Tropical Forest Soil | MARIEGADPGKQGFFQGMFTRVIYALTKRKVGRVVMPAQITAHHSKLLWG |
| Ga0066903_1045990762 | 3300005764 | Tropical Forest Soil | MARIDGAKPANQGFFQGMLTRTLYAMVKRKLGRVVMPVQITAHHGKVLWGY |
| Ga0075028_1007289772 | 3300006050 | Watersheds | MARIQGAEPSKQGLIGLFTRMVYSLTKRKVGRVVMPVQIVA |
| Ga0075028_1010093761 | 3300006050 | Watersheds | MAHIPGADPGRQGLISGLFTRLVYALTKRKLGRVVMPVQVTAHHSKI |
| Ga0075029_1001074691 | 3300006052 | Watersheds | MARIDGADPSQQGMLQGLFTRIIYALVKRKVGRVVMPAKIAAHHGKILWGYGQME |
| Ga0075026_1009963261 | 3300006057 | Watersheds | MARIRGAEPREQGLLSGLFTRIIYWLVKRKLGRVVMPVQIVANHSRI |
| Ga0075017_1014106702 | 3300006059 | Watersheds | MARIQGADPSRQGLVSGLFTRIVYALTNRKLGRVVTPVQVT |
| Ga0070765_1009694493 | 3300006176 | Soil | MARIRGADPSKQGLVRGLFTRIVYRMTRKKVGRVVMPVQLVAHHPKLL |
| Ga0066710_1025986411 | 3300009012 | Grasslands Soil | MARISGADPSKQGLLSGLLTRIVYGLTKRKLGRLVTPIRIAAHHSKILLGD |
| Ga0099828_107836141 | 3300009089 | Vadose Zone Soil | MNMARIAGADPRQQGLFHGLFMRIIYSMTKRKLGRVVMPVKIAAHHPK |
| Ga0099827_107161901 | 3300009090 | Vadose Zone Soil | MARISGAEPGQQGLVSGLFTRIAYAMTKRKVGRVVKPVQIMAHHTRLLW |
| Ga0099827_119395831 | 3300009090 | Vadose Zone Soil | MAMARIGAAEPNQQGLVQGLFTRVIYSMVKRKVGRVV |
| Ga0126380_120154551 | 3300010043 | Tropical Forest Soil | MARLRGADPGKQGLVGGLLTRLAYALTKRKVGRVV |
| Ga0134109_101120083 | 3300010320 | Grasslands Soil | MTMARIAGADPNQQGLFHSLFTRIIYALTKRKVGRVVM |
| Ga0126370_124635081 | 3300010358 | Tropical Forest Soil | MARIRGADPSKQGPLRGLFTRIVYAMTKRKVGRVV |
| Ga0126372_125470181 | 3300010360 | Tropical Forest Soil | MARIRGADPSKQGPLRGLFTRIVYAMTKRKVGRVVTPVQLIAHHPKLLWS |
| Ga0126378_102480373 | 3300010361 | Tropical Forest Soil | MARLQGADPGKQGWARGLLTRVAYALTKRKVGRVVMPVQIVSHH |
| Ga0126381_1003520585 | 3300010376 | Tropical Forest Soil | MARLRGADPGKQGLLGGLLTHLAYALTKRKVGRVVMPVQIVAHHSRILWGQAQMEL |
| Ga0137392_105875052 | 3300011269 | Vadose Zone Soil | MARISGAEPGQQGLLRGLFTRIAYAMTKRKVGRVVKPVQIMA |
| Ga0137392_107194251 | 3300011269 | Vadose Zone Soil | MAMARISGVDPKQQGFWNGLFTRVIYAMTKRKVGRVVM |
| Ga0137392_109025511 | 3300011269 | Vadose Zone Soil | MAMVRISGVDPKQQGFWNGLFTRVIYAMTKRKVGRVVMPVKI |
| Ga0137391_107689502 | 3300011270 | Vadose Zone Soil | MARLRGADPGKQGLLSGLLTHVAYALTKRKVGRVVMPVQI |
| Ga0137389_112222671 | 3300012096 | Vadose Zone Soil | MPMARIGGADPSQQGLLHGLFTRIVYSLTKRKVGRVVMPVKIA |
| Ga0137388_100722471 | 3300012189 | Vadose Zone Soil | MARNGGADPSQQGPFHGLFTRIIYSMTKRKLGRVVMPVKITAHHPKL |
| Ga0137388_114913971 | 3300012189 | Vadose Zone Soil | MARIRAADPKQQGLLQSLFTRIVYSMTKRKVGRVVMPVKIAAHHAKLLWGY |
| Ga0137363_107332271 | 3300012202 | Vadose Zone Soil | MAMARISGVEPKQQGFWNGLFTRFIYAMTKRKVGRVVMPVKIAAHHPKILWG |
| Ga0137381_100755352 | 3300012207 | Vadose Zone Soil | MARISEANPSQQGLFHGLFTRIIYSMVKRKLGRVVMPVKIVAHHRKLLWGYGQMEQ* |
| Ga0137381_118005001 | 3300012207 | Vadose Zone Soil | MARISGADPSRQSSFSGLFTRIVYALTKRKLGRVVGPVQVKA |
| Ga0137379_105012621 | 3300012209 | Vadose Zone Soil | MAMARISGVDPKQQGFWNGLFTRFIYAMTKRKVGRVVMPVKIAAH |
| Ga0137378_116448821 | 3300012210 | Vadose Zone Soil | MAMARISGVDPKQQGFWNGLFTRFIYAMTKRKVGRVV |
| Ga0137360_100193136 | 3300012361 | Vadose Zone Soil | MARITGADPSQQGLFHGLFTRIIYSMVKRKLGRVVTPVKIVAHHRKLLWG |
| Ga0137390_104565521 | 3300012363 | Vadose Zone Soil | MAMVRISGVDPKQQGFWNGLFTRVIYAMTKRKVGRVVMPVKIAAH |
| Ga0137390_110808841 | 3300012363 | Vadose Zone Soil | MARISGAEPGQQGLVSGLLTRIAYAMTKRKVGRVVKPVQIMAHHTRLLW |
| Ga0137398_101375451 | 3300012683 | Vadose Zone Soil | MARIGGAERNQQGLLQGLFTRIIYSMANRKVGRVVMPVKIAAHH |
| Ga0137397_105644442 | 3300012685 | Vadose Zone Soil | MARIQGAQPKGLFTRIAYALTKRKVGRVVMPVQIVAHHPKIL |
| Ga0137395_109417601 | 3300012917 | Vadose Zone Soil | MARVAGSDPAQHSFLSGLFIRIVYALTKRKVGRVV |
| Ga0137396_101088254 | 3300012918 | Vadose Zone Soil | MARISGAEPGKRGLLSGLFTRMVYALTKRKVGRVVMPVRIVAHH |
| Ga0137419_100007541 | 3300012925 | Vadose Zone Soil | MARIGGAERNQQGLLQGLFTRIIYSMAKRKVGRVVMPVKIAAHHAKLLW |
| Ga0137416_115798602 | 3300012927 | Vadose Zone Soil | MTMSRIAGAAPSQQGLFHGLFTRIIYALTKRKVGRVVMPVKIAAH |
| Ga0137404_107302692 | 3300012929 | Vadose Zone Soil | MARIPAADPSQQGLLHGIFTRIIYSMVKRKVGRVVMPVKIAAHHAKLLW |
| Ga0164301_112043141 | 3300012960 | Soil | MARILGAEPGRQRLLGGLLTRLAYALTKRKVGRVVMPVQIVAHHSKILWGYA |
| Ga0137403_102524341 | 3300015264 | Vadose Zone Soil | MARIPAADPSQQGLLHGIFTRIIYSMVKRKVGRVVMPVKIAAHHAKLLWGYGQME |
| Ga0187821_101042121 | 3300017936 | Freshwater Sediment | MARIEGAEPGKQSFLQGMFTRIIYALTKSKVGRVVMPVRIAAHHAKLLWGYGQME |
| Ga0187861_100394511 | 3300018020 | Peatland | MARVAGADPKRQDWLSGLLTRIVYGMTKRKLGRVIAPVEVTAHHAR |
| Ga0187859_106018292 | 3300018047 | Peatland | MARIEGADPRKQGWLAGLFTGIVYSVTKRKVGRVIEPTKITAHHS |
| Ga0066667_111327242 | 3300018433 | Grasslands Soil | MARISGADPNKQGLLSGLLTRIVYGMTKRKLGRLVMPVRIAAHH |
| Ga0210401_103813571 | 3300020583 | Soil | MARIRGAEPSKQGLVSGLFTRIVYAMTRRKVGRVVMPVRLVAHHSK |
| Ga0210404_107377401 | 3300021088 | Soil | MSRIRGADPSQQGFLAGLFTRIVYALTKRKLGRVVHPVQVT |
| Ga0210405_104508661 | 3300021171 | Soil | MARIRGADPSRQGLLNGRFTRIVYAITKRKVGRVVMPVQLIAHHPKLLWSYGLLEE |
| Ga0210389_114207551 | 3300021404 | Soil | MARIRGAEPSRLGLFGGLLTRIVYALTKRKLGRVVMPVQ |
| Ga0210384_102179702 | 3300021432 | Soil | MARISGADPSKQGLLSGLLTRIVYGLTKRKLGRLVMPVRIAAH |
| Ga0126371_133873271 | 3300021560 | Tropical Forest Soil | MARIRGAEPSKQGLLSGLFTRIVYGMTRRKVGRIVMPVQLVAHHPKLLWGYG |
| Ga0247664_10850022 | 3300024232 | Soil | MARLRGADPGKQGLLSGLLTHVAYALTKRKVGRVVMPVQIVAHHSRILWGHAQ |
| Ga0208035_10628462 | 3300025406 | Peatland | MARIEGADPRKQGWLAGLFTGIVYSVTKRKVGRVIEPTKITAHHSRI |
| Ga0208323_10573251 | 3300025439 | Peatland | MTRMHGADPSQQGFLRALFTRLVYAMTRRKVGRVV |
| Ga0208455_10087951 | 3300025453 | Peatland | MARVAGADPKRQDWLSGLLTRIVYGMTKRKLGRVIAPVEVTAHHARI |
| Ga0208191_10096251 | 3300025496 | Peatland | MTRMHGADPSQQGFLRALFTRLVYAMTRRKVGRVVMP |
| Ga0207642_101686711 | 3300025899 | Miscanthus Rhizosphere | MARISGADPSKQRWLSGLLTRIVYGLTKRKVGRLVMPVRIAAHHSK |
| Ga0207646_106703831 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MARIQGAEPSKQRMLSGLLTRVVYTLTKRKVGRVVMPVQIVAHHPKI |
| Ga0209240_10781261 | 3300026304 | Grasslands Soil | MARISGAEPGQQGLVSGLLTRIAYAMTKRKVGRVVKPVQIMAHHTRLLWG |
| Ga0209377_10666032 | 3300026334 | Soil | MARISGADPRKKGLLSGLLVRLFYWLTKRKLGKVVMPVQITSHHP |
| Ga0257158_11006512 | 3300026515 | Soil | MARINGADPSKQGLLQGLFTRIIYGMVKRKVGRVVVPAKIA |
| Ga0209577_100399874 | 3300026552 | Soil | MARIAGADPNQQGLFHSLFTRIIYALTKRKVGRVVMPVKLAAHH |
| Ga0209588_12219792 | 3300027671 | Vadose Zone Soil | MARIGGAERNQQGLLQGLFTRIIYSMANRKVGRVVMPVKIAGHHAKLLW |
| Ga0209580_106704412 | 3300027842 | Surface Soil | MARIRGAEPSQQGLFGGLLTRIVYALTKRKLGRVVMPVQVTAHHPQILWGY |
| Ga0209283_101224913 | 3300027875 | Vadose Zone Soil | MARISGADPRKKGLLSGLLVRLFYWLTKRKLGKVVMPVQITSHNP |
| Ga0209068_105316172 | 3300027894 | Watersheds | MTRVDGANPSRQGLFAGLLTRIVYALTRRKLGRVVAPVQVT |
| Ga0310039_103764192 | 3300030706 | Peatlands Soil | MARIAGADPKRQGWLSGLWTRIVYGMTKRKLGRVIAPVQVTAHH |
| Ga0170824_1059855042 | 3300031231 | Forest Soil | MARIRGADPSKQGLLRGLFTRIVYAMTKRKVGRVVMPVQLIAHH |
| Ga0318537_101650081 | 3300031763 | Soil | MARIEGADPSKQGLLQGLFTRVVYSLTKRKVGRTVLPVRIAAHHAK |
| Ga0318509_106591531 | 3300031768 | Soil | MARISGADPSRHGLWSGLFTRIVYALTRRKVGRVVMPVQLTAHHPVILW |
| Ga0318566_105042422 | 3300031779 | Soil | MARLRGADPWKQGLLGGLLTHIAYALTKRKVGRVVMPVQIVANHSRI |
| Ga0318552_103217722 | 3300031782 | Soil | MARLRGADPWKQGLLGGLLTHIAYALTKRKVGRVVMPVQIVANHS |
| Ga0307473_112711781 | 3300031820 | Hardwood Forest Soil | MARLRGADPGKQGLVSGLLTHVAYALTKRKVGRVVMPVQI |
| Ga0307478_111398502 | 3300031823 | Hardwood Forest Soil | MARVAGADPNQQGLFHGLFTRIIYSMAKHKVGRVVMPVKIA |
| Ga0306925_114993831 | 3300031890 | Soil | MARISGADPSRQRLWSGLFTRIVYALTRRKVGRVVMPV |
| Ga0306921_114800262 | 3300031912 | Soil | YHEVNAMARIRGAERGKQGLVSGLFTRIVYATTRRRVARVVMAVQLVVTRR |
| Ga0310916_103933463 | 3300031942 | Soil | MARLRGADPWKQGLLGGLLTHIAYALTKRKVGRVVMP |
| Ga0318507_100470972 | 3300032025 | Soil | MSRIPGADPSKLGFVSRLFTRVVYSLTRSKLGRVVMPVQVTAHHPT |
| Ga0318506_100728151 | 3300032052 | Soil | MARLRGAGPGKQGLLGGLLTHIAYTLTKRKVGRVVMP |
| Ga0318575_104359252 | 3300032055 | Soil | MARLRGADPWKQGLLGGLLTHIAYALTKRKVGRVVMPVQIVANHSRILW |
| Ga0311301_110611611 | 3300032160 | Peatlands Soil | MARIDGADPSKQGLLQGLFTKIIYAMVKRKVGRVVMP |
| Ga0306920_1001565522 | 3300032261 | Soil | MARIRGAERGKQGLVSGLFTRIVYATTRRRVARVVMAVQLVVTRR |
| ⦗Top⦘ |