| Basic Information | |
|---|---|
| Family ID | F105549 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MENPKHMENTLASSSGTVSPEDQSKNTSTESKCPFNHGASAPTNRDWW |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 98.00 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 3.95% β-sheet: 0.00% Coil/Unstructured: 96.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01475 | FUR | 87.00 |
| PF00106 | adh_short | 1.00 |
| PF01381 | HTH_3 | 1.00 |
| PF03900 | Porphobil_deamC | 1.00 |
| PF01145 | Band_7 | 1.00 |
| PF13847 | Methyltransf_31 | 1.00 |
| PF00682 | HMGL-like | 1.00 |
| PF13424 | TPR_12 | 1.00 |
| PF00005 | ABC_tran | 1.00 |
| PF07681 | DoxX | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 87.00 |
| COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 1.00 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.00 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100243845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1685 | Open in IMG/M |
| 3300004080|Ga0062385_10073859 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
| 3300004080|Ga0062385_10494536 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300004080|Ga0062385_11130399 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300004092|Ga0062389_103811327 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300004479|Ga0062595_101222072 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005445|Ga0070708_101157034 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005468|Ga0070707_101250632 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005518|Ga0070699_100889690 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300005586|Ga0066691_10088229 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300005591|Ga0070761_10895650 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005602|Ga0070762_10518114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
| 3300005610|Ga0070763_10452422 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005840|Ga0068870_10653692 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005994|Ga0066789_10082165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1392 | Open in IMG/M |
| 3300006028|Ga0070717_10396083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1240 | Open in IMG/M |
| 3300006176|Ga0070765_101553336 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300006176|Ga0070765_101892635 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300006237|Ga0097621_102406527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
| 3300006358|Ga0068871_101902484 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006871|Ga0075434_100992079 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300006904|Ga0075424_102190296 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300007258|Ga0099793_10422754 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300009093|Ga0105240_12813855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
| 3300009177|Ga0105248_10935590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 979 | Open in IMG/M |
| 3300009624|Ga0116105_1012236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1751 | Open in IMG/M |
| 3300009646|Ga0116132_1269356 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010303|Ga0134082_10499309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 531 | Open in IMG/M |
| 3300010373|Ga0134128_11291594 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300010376|Ga0126381_100717073 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300010396|Ga0134126_11710692 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300010861|Ga0126349_1172112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 589 | Open in IMG/M |
| 3300012202|Ga0137363_11529656 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300012212|Ga0150985_123086509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 633 | Open in IMG/M |
| 3300012349|Ga0137387_10982622 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012582|Ga0137358_10114650 | All Organisms → cellular organisms → Bacteria | 1829 | Open in IMG/M |
| 3300012923|Ga0137359_11624068 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012925|Ga0137419_10597186 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300012929|Ga0137404_11767365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300012929|Ga0137404_12123494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
| 3300012930|Ga0137407_10594711 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300012985|Ga0164308_10857838 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300014162|Ga0181538_10563636 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300014169|Ga0181531_11078626 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300014501|Ga0182024_10698751 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300015054|Ga0137420_1400655 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300015264|Ga0137403_10952824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300015374|Ga0132255_101118831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1184 | Open in IMG/M |
| 3300017946|Ga0187879_10677888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300017955|Ga0187817_10848831 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300017998|Ga0187870_1229066 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300018433|Ga0066667_10742882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 827 | Open in IMG/M |
| 3300020021|Ga0193726_1326675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300020582|Ga0210395_10268362 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300021180|Ga0210396_10980149 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300021402|Ga0210385_10737849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300021402|Ga0210385_11077145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 617 | Open in IMG/M |
| 3300021433|Ga0210391_10236296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1435 | Open in IMG/M |
| 3300021479|Ga0210410_10445179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1159 | Open in IMG/M |
| 3300021559|Ga0210409_10952822 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300022508|Ga0222728_1072230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300022733|Ga0224562_1004316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1080 | Open in IMG/M |
| 3300025911|Ga0207654_10848120 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300025912|Ga0207707_10028644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4868 | Open in IMG/M |
| 3300025927|Ga0207687_10910203 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300025927|Ga0207687_10992052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300025928|Ga0207700_10448988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 59-55 | 1136 | Open in IMG/M |
| 3300025938|Ga0207704_10262165 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300025939|Ga0207665_11145890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300025940|Ga0207691_11218579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 624 | Open in IMG/M |
| 3300026023|Ga0207677_10164766 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300026095|Ga0207676_10727592 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300026142|Ga0207698_10254862 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
| 3300026294|Ga0209839_10110000 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300026333|Ga0209158_1169672 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300027505|Ga0209218_1009284 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300027562|Ga0209735_1038373 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300027667|Ga0209009_1026269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1426 | Open in IMG/M |
| 3300027681|Ga0208991_1044394 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300028776|Ga0302303_10151597 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300028798|Ga0302222_10070534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1404 | Open in IMG/M |
| 3300028806|Ga0302221_10176269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 938 | Open in IMG/M |
| 3300028863|Ga0302218_10248665 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300028906|Ga0308309_11582146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300029889|Ga0246001_1032080 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300029910|Ga0311369_10201922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1850 | Open in IMG/M |
| 3300030509|Ga0302183_10201317 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300031057|Ga0170834_103051927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300031090|Ga0265760_10024646 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300031128|Ga0170823_14968182 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300031231|Ga0170824_113692171 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031718|Ga0307474_11351342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 562 | Open in IMG/M |
| 3300031740|Ga0307468_102284196 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031754|Ga0307475_10057271 | All Organisms → cellular organisms → Bacteria | 2946 | Open in IMG/M |
| 3300031754|Ga0307475_11288035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 566 | Open in IMG/M |
| 3300031823|Ga0307478_10953461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300031962|Ga0307479_11724507 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300032120|Ga0316053_113645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300032121|Ga0316040_109908 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300032180|Ga0307471_103327202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 569 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032121 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1002438454 | 3300002245 | Forest Soil | MENPKHMENTLASSSGTVSPEDQGKNTSTESKCPFNH |
| Ga0062385_100738594 | 3300004080 | Bog Forest Soil | MENTLATSSGSVSPETKNKSTLPEAKCPFNHGASVPTNRDWW |
| Ga0062385_104945362 | 3300004080 | Bog Forest Soil | MENPKHMENTLASSSGTVSPEDQSKNTSTESKCPFNHGASAPTNRDWW |
| Ga0062385_111303992 | 3300004080 | Bog Forest Soil | MENPTHMENTLASSSGTVSPEDQSKDTSSASKCPFNHGAA |
| Ga0062389_1038113271 | 3300004092 | Bog Forest Soil | MENPTHMENTLASSSGTVSPEDQSKDTSSASKCPFNHGAAAPTNRDWWPSQV |
| Ga0062595_1012220722 | 3300004479 | Soil | MENPKHMENTLASSSGTVSPEAPVKGQVKDQSQHASTESKCPFNH |
| Ga0070708_1011570342 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MENPKHMENTLASSSGTVSPEDQSKNTSTESRCPFNHGASAPK |
| Ga0070707_1012506322 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MENPTHMENTLASSSGTVSPESQSKVQSKVQSKVQSKVQGKDQSTESKCP |
| Ga0070699_1008896902 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MANPKHMENTLAASSGTVSPEDQSKNKSTESKCPFNHGASAPTNRDWWP |
| Ga0066691_100882293 | 3300005586 | Soil | MENPTHIENTLASSSGTVSPESQSKVQGKVQDKDQSTESKCPFNHGASAPTNRDWWPNQVDLQ |
| Ga0070761_108956502 | 3300005591 | Soil | MQSRLEGQKHMENTLATSSGSVSPEAKNKSTLPEAKCPFNHGASAPTNRDWWPKQL |
| Ga0070762_105181143 | 3300005602 | Soil | MENTLANSSGSVSPEAKNKSTLPEAKCPFNHGASA |
| Ga0070763_104524221 | 3300005610 | Soil | MENTLATSSGSVSPETKNKSTLPEAKCPFNHGASVPTNRDWWPNQVNVN |
| Ga0068870_106536921 | 3300005840 | Miscanthus Rhizosphere | MENPKHMENTLASSSGTVSPEDQSKNTSTESRCPFNHGASAP |
| Ga0066789_100821651 | 3300005994 | Soil | MENPKHMENTLASSSGTVSPEVRGKDQGKNPSTESKCPFNHG |
| Ga0070717_103960831 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDNPKVTENALASSSGTVSPEDQGKNNSTESKCPFNHGA |
| Ga0070765_1015533362 | 3300006176 | Soil | MENTLANSSGSVSPETKNKSTLPEAKCPFNHAASVPTNRDWWPKQVN |
| Ga0070765_1018926351 | 3300006176 | Soil | MENPTHMENTLASSSGTVSPENQTKNTSAESKCPFNHGASAPTNRDWW |
| Ga0097621_1024065271 | 3300006237 | Miscanthus Rhizosphere | MENAKHMENTLASSSGTVSPEDQNKDQSKNASIESKCPVAHGARKSPSNADWWPNQLNL |
| Ga0068871_1019024841 | 3300006358 | Miscanthus Rhizosphere | MENPKHMENTIASSSGTVSPEDQGKNTNGAKCPFNHGASAPTNRDWWPN |
| Ga0075434_1009920791 | 3300006871 | Populus Rhizosphere | MENAKHMENTLASSSGTVSPEDQNKDQSKNASIESKCPVAHGARKSPSNADWWPNQLNLQ |
| Ga0075424_1021902962 | 3300006904 | Populus Rhizosphere | MENAKQMENTLASSSGTVSPENQEKSKSNGAKCPFNHGASAPTNRDWWPNQVN |
| Ga0099793_104227542 | 3300007258 | Vadose Zone Soil | MENPTHVENTLASSSGTVSPESQSKVQGKDQSTESKCPFN |
| Ga0105240_128138552 | 3300009093 | Corn Rhizosphere | MGFVRSLQLRINSEEKFMENSRMENTVASSSGTVSPEKEDKSSEYKCPFNHGASSATNRDWWPNQV |
| Ga0105248_109355901 | 3300009177 | Switchgrass Rhizosphere | MENAKQMENTLASSSGTVSPENQEKSKSNGAKCPFNHGASAPTNRDWW |
| Ga0116105_10122363 | 3300009624 | Peatland | MENPKHMENTLASSSGTVSPEVQDNVQDNKKSIESKCPFNHGASAPTNRDWWPNQV |
| Ga0116132_12693561 | 3300009646 | Peatland | MENPTHMENTLASSSGTVSPEVQDKVQDKNKSTESKCPFHHGASAPTNR |
| Ga0134082_104993092 | 3300010303 | Grasslands Soil | MEKTKQMENTLASSSGTVSPEVQVKDQGKNASTESKCPFNHGASAPTN |
| Ga0134128_112915943 | 3300010373 | Terrestrial Soil | MENSRMENTVASSSGTVSPEKQDKSTQPESKCPFNH |
| Ga0126381_1007170732 | 3300010376 | Tropical Forest Soil | MEKTTHMDNTLASSSGTVSPENQEKKTESKCPFNH |
| Ga0134126_117106922 | 3300010396 | Terrestrial Soil | MIMDNSKMENTIASSSGSVSPELENKDTQTAAKCPFN |
| Ga0126349_11721122 | 3300010861 | Boreal Forest Soil | MENPKHMENTLASSSGTVSPEDQSKNTSSESKCPFNHGASAPTNHDW |
| Ga0137363_115296561 | 3300012202 | Vadose Zone Soil | MENPTHMENTLASSSGTVSPEIQSKVQGKDQSTESKCPFNHGASAPTNRDWWPNQVD |
| Ga0150985_1230865092 | 3300012212 | Avena Fatua Rhizosphere | METPKHMENTLASSSGSVSPEDQGQNTSTQSKCPVMHGAHRSNT |
| Ga0137387_109826222 | 3300012349 | Vadose Zone Soil | MENPTHIENTLASSSGTVSPESQSKVQGKDQSTESKC |
| Ga0137358_101146504 | 3300012582 | Vadose Zone Soil | MENQKYMENTLASSSGTVSPEVQVKDQGKNAATESK |
| Ga0137359_116240682 | 3300012923 | Vadose Zone Soil | MENPTHIENTLASSSGTVSPESQSKVQGKDQSTESKCPFNHGASAP |
| Ga0137419_105971863 | 3300012925 | Vadose Zone Soil | MENPTHMENTLASSSGTVSPESQSKGQGKNQPTES |
| Ga0137404_117673652 | 3300012929 | Vadose Zone Soil | MENTIASSSGTVSPENQEKSTGAKCPFNHGASAPTNRDWW |
| Ga0137404_121234942 | 3300012929 | Vadose Zone Soil | MNNPKQMENTLASSSGTVSPEDQQKNSTESKCPFNHGASA |
| Ga0137407_105947113 | 3300012930 | Vadose Zone Soil | MANPKHMENTLAASSGTVSPEDQSKNKSTESKCPFNHGA |
| Ga0164308_108578381 | 3300012985 | Soil | MENPKHMENTLASSSGTVSPEEQSKNTSTASKCPFNHGASAPSNRDWW |
| Ga0181538_105636362 | 3300014162 | Bog | MENPTHMENTLASSSGTVSPELQGKDQSKTESKCPVMGGARTHTAATNVDWWPNQL |
| Ga0181531_110786261 | 3300014169 | Bog | MKNPTHMENTLASSSGTVSPEDQSKTESKCPFNHG |
| Ga0182024_106987511 | 3300014501 | Permafrost | MNSKEKHMENPKHMENTLASSSGTVSPEDQGKNKSTESKCPFNHGASAPTNRDWWPNQV |
| Ga0137420_14006553 | 3300015054 | Vadose Zone Soil | MENTLASSSGTVSPESQSKGQGKNQPTESKCPFNHGASAPTNRDWWPNQ |
| Ga0137403_109528242 | 3300015264 | Vadose Zone Soil | MDHMENTIASSSGTVSPENQEKSTGAKCPFNHGASAPTNRDWW |
| Ga0132255_1011188311 | 3300015374 | Arabidopsis Rhizosphere | MENPKHMENTIASSSGTVSPEDQGKNTNGAKCPFNHGASAPTNRDWWPNQ |
| Ga0187879_106778882 | 3300017946 | Peatland | MENTLATSSGSVSPETKDKSTLAEAKCPFNHGASVPT |
| Ga0187817_108488312 | 3300017955 | Freshwater Sediment | MENTTHMENTLASSSGTVSPEYQDNKKSTESKCPF |
| Ga0187870_12290662 | 3300017998 | Peatland | MENPTHMENTLASSSGTVSPEVQDKVQDKNKSTESKCPFHHGASAPTNRDWWPNQ |
| Ga0066667_107428822 | 3300018433 | Grasslands Soil | MENPKHMENTVASSSGSVSPEDQRKNTTESKCPFNHGASSP |
| Ga0193726_13266751 | 3300020021 | Soil | MENTLATSSGSVSPEAKDKNTATESKCPFNHGASAPTNR |
| Ga0210395_102683621 | 3300020582 | Soil | MENTLATSSGSVSPEAKDKSTSPEAKCPFNHGASVPTNRDW |
| Ga0210396_109801491 | 3300021180 | Soil | MENPTHMENTLASSSGTVSPEDQSKNPSTESKCPFNHGASA |
| Ga0210385_107378492 | 3300021402 | Soil | MENTLANSSGSVSPEAKNKSTLPEAKCPFNHAAYVHTN |
| Ga0210385_110771452 | 3300021402 | Soil | MENPTHMENTLASSSGTVSPEDRSKEKSTGAKCPFNHGASAPTNRDWW |
| Ga0210391_102362963 | 3300021433 | Soil | MENTLANSSGSVSPEAKNKSTLPEAKCPFNHGASVP |
| Ga0210410_104451793 | 3300021479 | Soil | MENTLATSSGSVSPEAKNKSTLPEAKCPFNHGASAPTNRDWW |
| Ga0210409_109528221 | 3300021559 | Soil | MENPKHMENTLASSSGTVSPEDQSKNTSSESKCPFDHGAS |
| Ga0222728_10722302 | 3300022508 | Soil | MENTLATSSGSVSPEAKNKSTLPEAKCPFNHGASAPTNRDWWPNQL |
| Ga0224562_10043161 | 3300022733 | Soil | MENTLATSSGSVSPEAKNKSTLPEAKCPFNHGASVPTNRDWW |
| Ga0207654_108481201 | 3300025911 | Corn Rhizosphere | MDNPTHMENTLASSSGTVSPENQSKNPSTESKCPFNHGASAPTNRD |
| Ga0207707_100286441 | 3300025912 | Corn Rhizosphere | MENPKHMENTLASSSGTVSPEDQSKNTSTASKCPFNHGAS |
| Ga0207687_109102032 | 3300025927 | Miscanthus Rhizosphere | MENSRMENTVASSSGTVSPEKQDKSTQPESKCPFNHG |
| Ga0207687_109920522 | 3300025927 | Miscanthus Rhizosphere | MENPKHMENTLASSSGTVSPEVQDKDQSKAPTESKCPFNHGASAPRNRDWWPSQVDL |
| Ga0207700_104489883 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MENAKHMENTLASSSGTVSPEDQSKNTSAESKCPVAHGPSARRNR |
| Ga0207704_102621651 | 3300025938 | Miscanthus Rhizosphere | MEKHMENTLASSSGTVSPEDQSKNTSTESRCPFNH |
| Ga0207665_111458902 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MENTLATSSGSVSPETTDKSTKPESKCPFNHGASAPTNRDWW |
| Ga0207691_112185791 | 3300025940 | Miscanthus Rhizosphere | MENPKHMENTLASSSGTVSPEDQSKDTSTESRCPFNHGA |
| Ga0207677_101647661 | 3300026023 | Miscanthus Rhizosphere | MENPKHMENTLASSSGTVSPEDQSKNTSTESRCPFNHGASAPKNRD |
| Ga0207676_107275922 | 3300026095 | Switchgrass Rhizosphere | MENPKHMENTLASSSGTVSPEDQSKNTSTESRCPFNHGAS |
| Ga0207698_102548623 | 3300026142 | Corn Rhizosphere | MENPKHMENTLASSSGTVSPEDQSKNTSTESRCPFNHGASAAKNR |
| Ga0209839_101100001 | 3300026294 | Soil | MENTLASSSGTVSPEDQDKSKSTESKCPFNHGASAPTNRDWWPHQ |
| Ga0209158_11696723 | 3300026333 | Soil | MENPTHMENTLASSSGTVSPESQSKGQGKVQGKDQS |
| Ga0209218_10092843 | 3300027505 | Forest Soil | MENTLANSSGSVSPEAKTKSTLPEAKCPFNHGASAPTNR |
| Ga0209735_10383731 | 3300027562 | Forest Soil | MENPTHMENTLASSSGTVSPEVQGKVQSNDQGKNKSTESKCPFN |
| Ga0209009_10262691 | 3300027667 | Forest Soil | MENPTHMENTLASSSGTVSPEVQSKDQSKNKSTESKCPFNHGASAPTNRDWWPNQVD |
| Ga0208991_10443941 | 3300027681 | Forest Soil | MENPTHMENTLASSSGTVSPESQSKVQGKDQSTESKCPF |
| Ga0302303_101515971 | 3300028776 | Palsa | MENPTHMENTLASSSGTVSPEDQSKDQSKTESKCPFNHGASAPSN |
| Ga0302222_100705343 | 3300028798 | Palsa | MENPTHMENTLASSSGTVSPEDQSKDQSKTESKCPFNHGASAPSNR |
| Ga0302221_101762691 | 3300028806 | Palsa | MENPTHMENTLASSSGTVSPEDQSKDQSKTESKCPFNHGA |
| Ga0302218_102486652 | 3300028863 | Palsa | MENPTHMENTLASSSGTVSPEDQSKDQSKTESKCPFNHGASAP |
| Ga0308309_115821462 | 3300028906 | Soil | MENTLATSSGSVSPEAKNKSTIPEAKCPFNHGASVPSNRDW |
| Ga0246001_10320801 | 3300029889 | Peat | MENPTHMENTLASSSGTVSPEVQDKVQDKNKSTESKCPFHH |
| Ga0311369_102019221 | 3300029910 | Palsa | MENTLASSSGTVSPEDQSKDQSKTESKCPFNHGASAPSN |
| Ga0302183_102013172 | 3300030509 | Palsa | MENPTHMENTLASSSGTVSPEDQSKDQSKTESKCPFNHGASAPSNRDWWPNQVN |
| Ga0170834_1030519271 | 3300031057 | Forest Soil | MDNTLATSSGSVSPETKDKSTLPEAKCPFNHGASAPTNRDWWPKQ |
| Ga0265760_100246463 | 3300031090 | Soil | MENTLATSSGSVSPEAKSKSTLPEAKCPFNHGASAPTNRDWWP |
| Ga0170823_149681822 | 3300031128 | Forest Soil | MENPKHMENTLASSSGTVSPEDKGKNASTGAKCPFNHGASAPTNRDWWPSQ |
| Ga0170824_1136921711 | 3300031231 | Forest Soil | MENPTHMENTLASSSGTVSPEDKGKSTNGAKCPFNH |
| Ga0307474_113513421 | 3300031718 | Hardwood Forest Soil | MENPKVMENTLASSSGTVSPEDQGKDQSKNNSTESKCPFNHGASAPTNRDWW |
| Ga0307468_1022841961 | 3300031740 | Hardwood Forest Soil | MENPTHMENTLASSSGTVSPESQSKVQSKVQSKVQSKYQGKNKSTETKCPFNH |
| Ga0307475_100572711 | 3300031754 | Hardwood Forest Soil | MENPTHMENTLASSSGTVSPESQSKVQGKDQSTESKCPFNHGASA |
| Ga0307475_112880351 | 3300031754 | Hardwood Forest Soil | MANPKHMENTLASSSGTVSPEDQSQNKSTESKCPFNHGASAPTNHDWWP |
| Ga0307478_109534611 | 3300031823 | Hardwood Forest Soil | MENTLATSSGSVSPEAKNKSTLPEAKCPFNHGASVPTNRDWWPN |
| Ga0307479_117245072 | 3300031962 | Hardwood Forest Soil | MENPTYMENTLASSSGTVSPESQSKVQSKVQGKDQSTESKCPFNHGASA |
| Ga0316053_1136452 | 3300032120 | Soil | MENTIATSSGSVSPEVKNKSTLPEAKCPFTHSAYVPTNRDWWPNQ |
| Ga0316040_1099081 | 3300032121 | Soil | MENPTHMENTFASSSGTVSPEFQSKVESKDQSKTESKC |
| Ga0307471_1033272021 | 3300032180 | Hardwood Forest Soil | MANPKHMENTLAASSGTVSPEDQSKNKSTESKCPFN |
| ⦗Top⦘ |