NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105549

Metagenome / Metatranscriptome Family F105549

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105549
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 44 residues
Representative Sequence MENPKHMENTLASSSGTVSPEDQSKNTSTESKCPFNHGASAPTNRDWW
Number of Associated Samples 93
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 98.00 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.13

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.000 % of family members)
Environment Ontology (ENVO) Unclassified
(26.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.95%    β-sheet: 0.00%    Coil/Unstructured: 96.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.13
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF01475FUR 87.00
PF00106adh_short 1.00
PF01381HTH_3 1.00
PF03900Porphobil_deamC 1.00
PF01145Band_7 1.00
PF13847Methyltransf_31 1.00
PF00682HMGL-like 1.00
PF13424TPR_12 1.00
PF00005ABC_tran 1.00
PF07681DoxX 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0735Fe2+ or Zn2+ uptake regulation protein Fur/ZurInorganic ion transport and metabolism [P] 87.00
COG0181Porphobilinogen deaminaseCoenzyme transport and metabolism [H] 1.00
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 1.00
COG4270Uncharacterized membrane proteinFunction unknown [S] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100243845All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1685Open in IMG/M
3300004080|Ga0062385_10073859All Organisms → cellular organisms → Bacteria1567Open in IMG/M
3300004080|Ga0062385_10494536All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300004080|Ga0062385_11130399All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300004092|Ga0062389_103811327All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300004479|Ga0062595_101222072All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300005445|Ga0070708_101157034All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300005468|Ga0070707_101250632All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300005518|Ga0070699_100889690All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300005586|Ga0066691_10088229All Organisms → cellular organisms → Bacteria1726Open in IMG/M
3300005591|Ga0070761_10895650All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005602|Ga0070762_10518114All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium783Open in IMG/M
3300005610|Ga0070763_10452422All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300005840|Ga0068870_10653692All Organisms → cellular organisms → Bacteria720Open in IMG/M
3300005994|Ga0066789_10082165All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1392Open in IMG/M
3300006028|Ga0070717_10396083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1240Open in IMG/M
3300006176|Ga0070765_101553336All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300006176|Ga0070765_101892635All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300006237|Ga0097621_102406527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae504Open in IMG/M
3300006358|Ga0068871_101902484All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300006871|Ga0075434_100992079All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300006904|Ga0075424_102190296All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300007258|Ga0099793_10422754All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300009093|Ga0105240_12813855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium500Open in IMG/M
3300009177|Ga0105248_10935590All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae979Open in IMG/M
3300009624|Ga0116105_1012236All Organisms → cellular organisms → Bacteria → Acidobacteria1751Open in IMG/M
3300009646|Ga0116132_1269356All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300010303|Ga0134082_10499309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium531Open in IMG/M
3300010373|Ga0134128_11291594All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300010376|Ga0126381_100717073All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300010396|Ga0134126_11710692All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300010861|Ga0126349_1172112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium589Open in IMG/M
3300012202|Ga0137363_11529656All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300012212|Ga0150985_123086509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium633Open in IMG/M
3300012349|Ga0137387_10982622All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300012582|Ga0137358_10114650All Organisms → cellular organisms → Bacteria1829Open in IMG/M
3300012923|Ga0137359_11624068All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300012925|Ga0137419_10597186All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300012929|Ga0137404_11767365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300012929|Ga0137404_12123494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium525Open in IMG/M
3300012930|Ga0137407_10594711All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300012985|Ga0164308_10857838All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300014162|Ga0181538_10563636All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300014169|Ga0181531_11078626All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300014501|Ga0182024_10698751All Organisms → cellular organisms → Bacteria1252Open in IMG/M
3300015054|Ga0137420_1400655All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300015264|Ga0137403_10952824All Organisms → cellular organisms → Bacteria → Acidobacteria706Open in IMG/M
3300015374|Ga0132255_101118831All Organisms → cellular organisms → Bacteria → Acidobacteria1184Open in IMG/M
3300017946|Ga0187879_10677888All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300017955|Ga0187817_10848831All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300017998|Ga0187870_1229066All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300018433|Ga0066667_10742882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium827Open in IMG/M
3300020021|Ga0193726_1326675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300020582|Ga0210395_10268362All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300021180|Ga0210396_10980149All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300021402|Ga0210385_10737849All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium754Open in IMG/M
3300021402|Ga0210385_11077145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium617Open in IMG/M
3300021433|Ga0210391_10236296All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1435Open in IMG/M
3300021479|Ga0210410_10445179All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1159Open in IMG/M
3300021559|Ga0210409_10952822All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300022508|Ga0222728_1072230All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300022733|Ga0224562_1004316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1080Open in IMG/M
3300025911|Ga0207654_10848120All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300025912|Ga0207707_10028644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4868Open in IMG/M
3300025927|Ga0207687_10910203All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300025927|Ga0207687_10992052All Organisms → cellular organisms → Bacteria → Acidobacteria720Open in IMG/M
3300025928|Ga0207700_10448988All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 59-551136Open in IMG/M
3300025938|Ga0207704_10262165All Organisms → cellular organisms → Bacteria1304Open in IMG/M
3300025939|Ga0207665_11145890All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300025940|Ga0207691_11218579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium624Open in IMG/M
3300026023|Ga0207677_10164766All Organisms → cellular organisms → Bacteria1726Open in IMG/M
3300026095|Ga0207676_10727592All Organisms → cellular organisms → Bacteria963Open in IMG/M
3300026142|Ga0207698_10254862All Organisms → cellular organisms → Bacteria1608Open in IMG/M
3300026294|Ga0209839_10110000All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300026333|Ga0209158_1169672All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300027505|Ga0209218_1009284All Organisms → cellular organisms → Bacteria1674Open in IMG/M
3300027562|Ga0209735_1038373All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300027667|Ga0209009_1026269All Organisms → cellular organisms → Bacteria → Acidobacteria1426Open in IMG/M
3300027681|Ga0208991_1044394All Organisms → cellular organisms → Bacteria1343Open in IMG/M
3300028776|Ga0302303_10151597All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300028798|Ga0302222_10070534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1404Open in IMG/M
3300028806|Ga0302221_10176269All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus938Open in IMG/M
3300028863|Ga0302218_10248665All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300028906|Ga0308309_11582146All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300029889|Ga0246001_1032080All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300029910|Ga0311369_10201922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1850Open in IMG/M
3300030509|Ga0302183_10201317All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300031057|Ga0170834_103051927All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M
3300031090|Ga0265760_10024646All Organisms → cellular organisms → Bacteria1754Open in IMG/M
3300031128|Ga0170823_14968182All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300031231|Ga0170824_113692171All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300031718|Ga0307474_11351342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium562Open in IMG/M
3300031740|Ga0307468_102284196All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031754|Ga0307475_10057271All Organisms → cellular organisms → Bacteria2946Open in IMG/M
3300031754|Ga0307475_11288035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium566Open in IMG/M
3300031823|Ga0307478_10953461All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300031962|Ga0307479_11724507All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300032120|Ga0316053_113645All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M
3300032121|Ga0316040_109908All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300032180|Ga0307471_103327202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium569Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil2.00%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere2.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.00%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.00%
PeatEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.00%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022508Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022733Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029889Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cmEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032120Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032121Soil microbial communities from Bohemian Forest, Czech Republic ? CSA3 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10024384543300002245Forest SoilMENPKHMENTLASSSGTVSPEDQGKNTSTESKCPFNH
Ga0062385_1007385943300004080Bog Forest SoilMENTLATSSGSVSPETKNKSTLPEAKCPFNHGASVPTNRDWW
Ga0062385_1049453623300004080Bog Forest SoilMENPKHMENTLASSSGTVSPEDQSKNTSTESKCPFNHGASAPTNRDWW
Ga0062385_1113039923300004080Bog Forest SoilMENPTHMENTLASSSGTVSPEDQSKDTSSASKCPFNHGAA
Ga0062389_10381132713300004092Bog Forest SoilMENPTHMENTLASSSGTVSPEDQSKDTSSASKCPFNHGAAAPTNRDWWPSQV
Ga0062595_10122207223300004479SoilMENPKHMENTLASSSGTVSPEAPVKGQVKDQSQHASTESKCPFNH
Ga0070708_10115703423300005445Corn, Switchgrass And Miscanthus RhizosphereMENPKHMENTLASSSGTVSPEDQSKNTSTESRCPFNHGASAPK
Ga0070707_10125063223300005468Corn, Switchgrass And Miscanthus RhizosphereMENPTHMENTLASSSGTVSPESQSKVQSKVQSKVQSKVQGKDQSTESKCP
Ga0070699_10088969023300005518Corn, Switchgrass And Miscanthus RhizosphereMANPKHMENTLAASSGTVSPEDQSKNKSTESKCPFNHGASAPTNRDWWP
Ga0066691_1008822933300005586SoilMENPTHIENTLASSSGTVSPESQSKVQGKVQDKDQSTESKCPFNHGASAPTNRDWWPNQVDLQ
Ga0070761_1089565023300005591SoilMQSRLEGQKHMENTLATSSGSVSPEAKNKSTLPEAKCPFNHGASAPTNRDWWPKQL
Ga0070762_1051811433300005602SoilMENTLANSSGSVSPEAKNKSTLPEAKCPFNHGASA
Ga0070763_1045242213300005610SoilMENTLATSSGSVSPETKNKSTLPEAKCPFNHGASVPTNRDWWPNQVNVN
Ga0068870_1065369213300005840Miscanthus RhizosphereMENPKHMENTLASSSGTVSPEDQSKNTSTESRCPFNHGASAP
Ga0066789_1008216513300005994SoilMENPKHMENTLASSSGTVSPEVRGKDQGKNPSTESKCPFNHG
Ga0070717_1039608313300006028Corn, Switchgrass And Miscanthus RhizosphereMDNPKVTENALASSSGTVSPEDQGKNNSTESKCPFNHGA
Ga0070765_10155333623300006176SoilMENTLANSSGSVSPETKNKSTLPEAKCPFNHAASVPTNRDWWPKQVN
Ga0070765_10189263513300006176SoilMENPTHMENTLASSSGTVSPENQTKNTSAESKCPFNHGASAPTNRDWW
Ga0097621_10240652713300006237Miscanthus RhizosphereMENAKHMENTLASSSGTVSPEDQNKDQSKNASIESKCPVAHGARKSPSNADWWPNQLNL
Ga0068871_10190248413300006358Miscanthus RhizosphereMENPKHMENTIASSSGTVSPEDQGKNTNGAKCPFNHGASAPTNRDWWPN
Ga0075434_10099207913300006871Populus RhizosphereMENAKHMENTLASSSGTVSPEDQNKDQSKNASIESKCPVAHGARKSPSNADWWPNQLNLQ
Ga0075424_10219029623300006904Populus RhizosphereMENAKQMENTLASSSGTVSPENQEKSKSNGAKCPFNHGASAPTNRDWWPNQVN
Ga0099793_1042275423300007258Vadose Zone SoilMENPTHVENTLASSSGTVSPESQSKVQGKDQSTESKCPFN
Ga0105240_1281385523300009093Corn RhizosphereMGFVRSLQLRINSEEKFMENSRMENTVASSSGTVSPEKEDKSSEYKCPFNHGASSATNRDWWPNQV
Ga0105248_1093559013300009177Switchgrass RhizosphereMENAKQMENTLASSSGTVSPENQEKSKSNGAKCPFNHGASAPTNRDWW
Ga0116105_101223633300009624PeatlandMENPKHMENTLASSSGTVSPEVQDNVQDNKKSIESKCPFNHGASAPTNRDWWPNQV
Ga0116132_126935613300009646PeatlandMENPTHMENTLASSSGTVSPEVQDKVQDKNKSTESKCPFHHGASAPTNR
Ga0134082_1049930923300010303Grasslands SoilMEKTKQMENTLASSSGTVSPEVQVKDQGKNASTESKCPFNHGASAPTN
Ga0134128_1129159433300010373Terrestrial SoilMENSRMENTVASSSGTVSPEKQDKSTQPESKCPFNH
Ga0126381_10071707323300010376Tropical Forest SoilMEKTTHMDNTLASSSGTVSPENQEKKTESKCPFNH
Ga0134126_1171069223300010396Terrestrial SoilMIMDNSKMENTIASSSGSVSPELENKDTQTAAKCPFN
Ga0126349_117211223300010861Boreal Forest SoilMENPKHMENTLASSSGTVSPEDQSKNTSSESKCPFNHGASAPTNHDW
Ga0137363_1152965613300012202Vadose Zone SoilMENPTHMENTLASSSGTVSPEIQSKVQGKDQSTESKCPFNHGASAPTNRDWWPNQVD
Ga0150985_12308650923300012212Avena Fatua RhizosphereMETPKHMENTLASSSGSVSPEDQGQNTSTQSKCPVMHGAHRSNT
Ga0137387_1098262223300012349Vadose Zone SoilMENPTHIENTLASSSGTVSPESQSKVQGKDQSTESKC
Ga0137358_1011465043300012582Vadose Zone SoilMENQKYMENTLASSSGTVSPEVQVKDQGKNAATESK
Ga0137359_1162406823300012923Vadose Zone SoilMENPTHIENTLASSSGTVSPESQSKVQGKDQSTESKCPFNHGASAP
Ga0137419_1059718633300012925Vadose Zone SoilMENPTHMENTLASSSGTVSPESQSKGQGKNQPTES
Ga0137404_1176736523300012929Vadose Zone SoilMENTIASSSGTVSPENQEKSTGAKCPFNHGASAPTNRDWW
Ga0137404_1212349423300012929Vadose Zone SoilMNNPKQMENTLASSSGTVSPEDQQKNSTESKCPFNHGASA
Ga0137407_1059471133300012930Vadose Zone SoilMANPKHMENTLAASSGTVSPEDQSKNKSTESKCPFNHGA
Ga0164308_1085783813300012985SoilMENPKHMENTLASSSGTVSPEEQSKNTSTASKCPFNHGASAPSNRDWW
Ga0181538_1056363623300014162BogMENPTHMENTLASSSGTVSPELQGKDQSKTESKCPVMGGARTHTAATNVDWWPNQL
Ga0181531_1107862613300014169BogMKNPTHMENTLASSSGTVSPEDQSKTESKCPFNHG
Ga0182024_1069875113300014501PermafrostMNSKEKHMENPKHMENTLASSSGTVSPEDQGKNKSTESKCPFNHGASAPTNRDWWPNQV
Ga0137420_140065533300015054Vadose Zone SoilMENTLASSSGTVSPESQSKGQGKNQPTESKCPFNHGASAPTNRDWWPNQ
Ga0137403_1095282423300015264Vadose Zone SoilMDHMENTIASSSGTVSPENQEKSTGAKCPFNHGASAPTNRDWW
Ga0132255_10111883113300015374Arabidopsis RhizosphereMENPKHMENTIASSSGTVSPEDQGKNTNGAKCPFNHGASAPTNRDWWPNQ
Ga0187879_1067788823300017946PeatlandMENTLATSSGSVSPETKDKSTLAEAKCPFNHGASVPT
Ga0187817_1084883123300017955Freshwater SedimentMENTTHMENTLASSSGTVSPEYQDNKKSTESKCPF
Ga0187870_122906623300017998PeatlandMENPTHMENTLASSSGTVSPEVQDKVQDKNKSTESKCPFHHGASAPTNRDWWPNQ
Ga0066667_1074288223300018433Grasslands SoilMENPKHMENTVASSSGSVSPEDQRKNTTESKCPFNHGASSP
Ga0193726_132667513300020021SoilMENTLATSSGSVSPEAKDKNTATESKCPFNHGASAPTNR
Ga0210395_1026836213300020582SoilMENTLATSSGSVSPEAKDKSTSPEAKCPFNHGASVPTNRDW
Ga0210396_1098014913300021180SoilMENPTHMENTLASSSGTVSPEDQSKNPSTESKCPFNHGASA
Ga0210385_1073784923300021402SoilMENTLANSSGSVSPEAKNKSTLPEAKCPFNHAAYVHTN
Ga0210385_1107714523300021402SoilMENPTHMENTLASSSGTVSPEDRSKEKSTGAKCPFNHGASAPTNRDWW
Ga0210391_1023629633300021433SoilMENTLANSSGSVSPEAKNKSTLPEAKCPFNHGASVP
Ga0210410_1044517933300021479SoilMENTLATSSGSVSPEAKNKSTLPEAKCPFNHGASAPTNRDWW
Ga0210409_1095282213300021559SoilMENPKHMENTLASSSGTVSPEDQSKNTSSESKCPFDHGAS
Ga0222728_107223023300022508SoilMENTLATSSGSVSPEAKNKSTLPEAKCPFNHGASAPTNRDWWPNQL
Ga0224562_100431613300022733SoilMENTLATSSGSVSPEAKNKSTLPEAKCPFNHGASVPTNRDWW
Ga0207654_1084812013300025911Corn RhizosphereMDNPTHMENTLASSSGTVSPENQSKNPSTESKCPFNHGASAPTNRD
Ga0207707_1002864413300025912Corn RhizosphereMENPKHMENTLASSSGTVSPEDQSKNTSTASKCPFNHGAS
Ga0207687_1091020323300025927Miscanthus RhizosphereMENSRMENTVASSSGTVSPEKQDKSTQPESKCPFNHG
Ga0207687_1099205223300025927Miscanthus RhizosphereMENPKHMENTLASSSGTVSPEVQDKDQSKAPTESKCPFNHGASAPRNRDWWPSQVDL
Ga0207700_1044898833300025928Corn, Switchgrass And Miscanthus RhizosphereMENAKHMENTLASSSGTVSPEDQSKNTSAESKCPVAHGPSARRNR
Ga0207704_1026216513300025938Miscanthus RhizosphereMEKHMENTLASSSGTVSPEDQSKNTSTESRCPFNH
Ga0207665_1114589023300025939Corn, Switchgrass And Miscanthus RhizosphereMENTLATSSGSVSPETTDKSTKPESKCPFNHGASAPTNRDWW
Ga0207691_1121857913300025940Miscanthus RhizosphereMENPKHMENTLASSSGTVSPEDQSKDTSTESRCPFNHGA
Ga0207677_1016476613300026023Miscanthus RhizosphereMENPKHMENTLASSSGTVSPEDQSKNTSTESRCPFNHGASAPKNRD
Ga0207676_1072759223300026095Switchgrass RhizosphereMENPKHMENTLASSSGTVSPEDQSKNTSTESRCPFNHGAS
Ga0207698_1025486233300026142Corn RhizosphereMENPKHMENTLASSSGTVSPEDQSKNTSTESRCPFNHGASAAKNR
Ga0209839_1011000013300026294SoilMENTLASSSGTVSPEDQDKSKSTESKCPFNHGASAPTNRDWWPHQ
Ga0209158_116967233300026333SoilMENPTHMENTLASSSGTVSPESQSKGQGKVQGKDQS
Ga0209218_100928433300027505Forest SoilMENTLANSSGSVSPEAKTKSTLPEAKCPFNHGASAPTNR
Ga0209735_103837313300027562Forest SoilMENPTHMENTLASSSGTVSPEVQGKVQSNDQGKNKSTESKCPFN
Ga0209009_102626913300027667Forest SoilMENPTHMENTLASSSGTVSPEVQSKDQSKNKSTESKCPFNHGASAPTNRDWWPNQVD
Ga0208991_104439413300027681Forest SoilMENPTHMENTLASSSGTVSPESQSKVQGKDQSTESKCPF
Ga0302303_1015159713300028776PalsaMENPTHMENTLASSSGTVSPEDQSKDQSKTESKCPFNHGASAPSN
Ga0302222_1007053433300028798PalsaMENPTHMENTLASSSGTVSPEDQSKDQSKTESKCPFNHGASAPSNR
Ga0302221_1017626913300028806PalsaMENPTHMENTLASSSGTVSPEDQSKDQSKTESKCPFNHGA
Ga0302218_1024866523300028863PalsaMENPTHMENTLASSSGTVSPEDQSKDQSKTESKCPFNHGASAP
Ga0308309_1158214623300028906SoilMENTLATSSGSVSPEAKNKSTIPEAKCPFNHGASVPSNRDW
Ga0246001_103208013300029889PeatMENPTHMENTLASSSGTVSPEVQDKVQDKNKSTESKCPFHH
Ga0311369_1020192213300029910PalsaMENTLASSSGTVSPEDQSKDQSKTESKCPFNHGASAPSN
Ga0302183_1020131723300030509PalsaMENPTHMENTLASSSGTVSPEDQSKDQSKTESKCPFNHGASAPSNRDWWPNQVN
Ga0170834_10305192713300031057Forest SoilMDNTLATSSGSVSPETKDKSTLPEAKCPFNHGASAPTNRDWWPKQ
Ga0265760_1002464633300031090SoilMENTLATSSGSVSPEAKSKSTLPEAKCPFNHGASAPTNRDWWP
Ga0170823_1496818223300031128Forest SoilMENPKHMENTLASSSGTVSPEDKGKNASTGAKCPFNHGASAPTNRDWWPSQ
Ga0170824_11369217113300031231Forest SoilMENPTHMENTLASSSGTVSPEDKGKSTNGAKCPFNH
Ga0307474_1135134213300031718Hardwood Forest SoilMENPKVMENTLASSSGTVSPEDQGKDQSKNNSTESKCPFNHGASAPTNRDWW
Ga0307468_10228419613300031740Hardwood Forest SoilMENPTHMENTLASSSGTVSPESQSKVQSKVQSKVQSKYQGKNKSTETKCPFNH
Ga0307475_1005727113300031754Hardwood Forest SoilMENPTHMENTLASSSGTVSPESQSKVQGKDQSTESKCPFNHGASA
Ga0307475_1128803513300031754Hardwood Forest SoilMANPKHMENTLASSSGTVSPEDQSQNKSTESKCPFNHGASAPTNHDWWP
Ga0307478_1095346113300031823Hardwood Forest SoilMENTLATSSGSVSPEAKNKSTLPEAKCPFNHGASVPTNRDWWPN
Ga0307479_1172450723300031962Hardwood Forest SoilMENPTYMENTLASSSGTVSPESQSKVQSKVQGKDQSTESKCPFNHGASA
Ga0316053_11364523300032120SoilMENTIATSSGSVSPEVKNKSTLPEAKCPFTHSAYVPTNRDWWPNQ
Ga0316040_10990813300032121SoilMENPTHMENTFASSSGTVSPEFQSKVESKDQSKTESKC
Ga0307471_10332720213300032180Hardwood Forest SoilMANPKHMENTLAASSGTVSPEDQSKNKSTESKCPFN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.