| Basic Information | |
|---|---|
| Family ID | F105539 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MDAALEDVQRQHPGAEVEEPFTRGYQRGREYYQRLCDQTKKAA |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01553 | Acyltransferase | 40.00 |
| PF12833 | HTH_18 | 8.00 |
| PF03544 | TonB_C | 7.00 |
| PF03412 | Peptidase_C39 | 6.00 |
| PF07244 | POTRA | 3.00 |
| PF04185 | Phosphoesterase | 3.00 |
| PF08245 | Mur_ligase_M | 3.00 |
| PF09335 | SNARE_assoc | 2.00 |
| PF13442 | Cytochrome_CBB3 | 2.00 |
| PF02371 | Transposase_20 | 2.00 |
| PF01546 | Peptidase_M20 | 2.00 |
| PF00034 | Cytochrom_C | 1.00 |
| PF13483 | Lactamase_B_3 | 1.00 |
| PF00903 | Glyoxalase | 1.00 |
| PF02590 | SPOUT_MTase | 1.00 |
| PF02875 | Mur_ligase_C | 1.00 |
| PF09970 | DUF2204 | 1.00 |
| PF00882 | Zn_dep_PLPC | 1.00 |
| PF00884 | Sulfatase | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 7.00 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 3.00 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 2.00 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 2.00 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.00 |
| COG1576 | 23S rRNA pseudoU1915 N3-methylase RlmH | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.00 % |
| Unclassified | root | N/A | 5.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005364|Ga0070673_100909379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300005456|Ga0070678_100163415 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300005542|Ga0070732_10768315 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300005542|Ga0070732_11006637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300005568|Ga0066703_10541660 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005598|Ga0066706_10990275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300005602|Ga0070762_10542459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300005764|Ga0066903_100184962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3082 | Open in IMG/M |
| 3300005764|Ga0066903_104756292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 722 | Open in IMG/M |
| 3300005952|Ga0080026_10027000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1427 | Open in IMG/M |
| 3300006028|Ga0070717_10576972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
| 3300006028|Ga0070717_11631691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300006059|Ga0075017_101618282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300006176|Ga0070765_102006394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300006893|Ga0073928_11143322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300009177|Ga0105248_10303809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1797 | Open in IMG/M |
| 3300009523|Ga0116221_1322648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 669 | Open in IMG/M |
| 3300009553|Ga0105249_10460157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
| 3300009792|Ga0126374_10798953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300010048|Ga0126373_12919547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300010358|Ga0126370_10793103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 844 | Open in IMG/M |
| 3300010361|Ga0126378_11086717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 901 | Open in IMG/M |
| 3300010361|Ga0126378_12492959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300010937|Ga0137776_1793824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
| 3300011271|Ga0137393_11585067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300012202|Ga0137363_11757528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300012211|Ga0137377_11148311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300012354|Ga0137366_10459816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300012469|Ga0150984_110989912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 782 | Open in IMG/M |
| 3300012923|Ga0137359_10294346 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300014165|Ga0181523_10197260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1167 | Open in IMG/M |
| 3300014745|Ga0157377_10135738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1507 | Open in IMG/M |
| 3300016319|Ga0182033_10051574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 2790 | Open in IMG/M |
| 3300017948|Ga0187847_10291926 | Not Available | 891 | Open in IMG/M |
| 3300017972|Ga0187781_10090411 | All Organisms → cellular organisms → Bacteria | 2119 | Open in IMG/M |
| 3300017995|Ga0187816_10189446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300018006|Ga0187804_10105905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
| 3300018058|Ga0187766_10847514 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300018062|Ga0187784_10013065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6706 | Open in IMG/M |
| 3300018482|Ga0066669_10425799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1132 | Open in IMG/M |
| 3300020078|Ga0206352_10302100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300020579|Ga0210407_10375290 | Not Available | 1113 | Open in IMG/M |
| 3300020580|Ga0210403_10022514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5031 | Open in IMG/M |
| 3300020581|Ga0210399_10088246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2524 | Open in IMG/M |
| 3300020582|Ga0210395_11106489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300020583|Ga0210401_10230557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1710 | Open in IMG/M |
| 3300021168|Ga0210406_11055083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300021178|Ga0210408_11100297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300021180|Ga0210396_10602355 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300021181|Ga0210388_10328944 | Not Available | 1343 | Open in IMG/M |
| 3300021401|Ga0210393_10691576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300021404|Ga0210389_11525845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300021406|Ga0210386_10086546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2548 | Open in IMG/M |
| 3300021407|Ga0210383_10152718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1963 | Open in IMG/M |
| 3300021432|Ga0210384_10843062 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300021432|Ga0210384_11184694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300021478|Ga0210402_10256252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1616 | Open in IMG/M |
| 3300021478|Ga0210402_10865237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300021559|Ga0210409_10720179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 869 | Open in IMG/M |
| 3300022557|Ga0212123_10086719 | All Organisms → cellular organisms → Bacteria | 2614 | Open in IMG/M |
| 3300022557|Ga0212123_10432737 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300022724|Ga0242665_10261332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300025711|Ga0207696_1175035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300026329|Ga0209375_1241122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300026334|Ga0209377_1326890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300026552|Ga0209577_10176218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1661 | Open in IMG/M |
| 3300027070|Ga0208365_1019432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300027073|Ga0208366_1022270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300027502|Ga0209622_1110574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300027575|Ga0209525_1082260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300027633|Ga0208988_1093819 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300027842|Ga0209580_10694709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300027884|Ga0209275_10073558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1697 | Open in IMG/M |
| 3300027884|Ga0209275_10266087 | Not Available | 944 | Open in IMG/M |
| 3300028379|Ga0268266_11263086 | Not Available | 714 | Open in IMG/M |
| 3300028906|Ga0308309_10627553 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300028906|Ga0308309_11616125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300029636|Ga0222749_10307911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300029951|Ga0311371_10721756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1247 | Open in IMG/M |
| 3300030053|Ga0302177_10097972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1700 | Open in IMG/M |
| 3300030878|Ga0265770_1148208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300031057|Ga0170834_101009011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300031128|Ga0170823_13387888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300031469|Ga0170819_15949661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300031573|Ga0310915_11235482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300031668|Ga0318542_10408596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 701 | Open in IMG/M |
| 3300031715|Ga0307476_11148313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300031718|Ga0307474_10614512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 857 | Open in IMG/M |
| 3300031720|Ga0307469_11632072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300031753|Ga0307477_10072642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2379 | Open in IMG/M |
| 3300031754|Ga0307475_10024980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4257 | Open in IMG/M |
| 3300031754|Ga0307475_11395017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 540 | Open in IMG/M |
| 3300031833|Ga0310917_10937218 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300031954|Ga0306926_10333533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1876 | Open in IMG/M |
| 3300031954|Ga0306926_12585519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300031962|Ga0307479_11720141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300032174|Ga0307470_11234135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300032515|Ga0348332_10334023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300032756|Ga0315742_11557950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
| 3300032896|Ga0335075_10941858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.00% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 1.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.00% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070673_1009093792 | 3300005364 | Switchgrass Rhizosphere | FDQVSAEMSATLEDVQRQYPNAKVEEPFTRGYQRGREYYQQLCDESKAA* |
| Ga0070678_1001634154 | 3300005456 | Miscanthus Rhizosphere | MNSSLEDVQKQYPNVDVSDAFLAGYQRGRDYYQRVCDESKAA* |
| Ga0070732_107683151 | 3300005542 | Surface Soil | DQVSAAMDAALEDVKQQYPGAKVEEPFLRGYQRGRDHYQQLCDEHRQAA* |
| Ga0070732_110066372 | 3300005542 | Surface Soil | FDQVSAEMDAALEDVKGRYPNSDVEEPFLQGYRRGREHYQQLCDENRRAA* |
| Ga0066703_105416601 | 3300005568 | Soil | FDQISGEMNAALDDVKAQYPGANVEEPFLAGYQRGREHYQQLCDETEQLVRE* |
| Ga0066706_109902752 | 3300005598 | Soil | EFDQVSGEMNAALEDVQRQYPGKQVEEPFTRGFRRGREHYQQLCDEQSRAA* |
| Ga0070762_105424592 | 3300005602 | Soil | VEFDQVSGEMNAALEDAQREHPGVQLEAAFTRGYQRGRDYYQQRCDETGKAA* |
| Ga0066903_1001849624 | 3300005764 | Tropical Forest Soil | EDVEHRFPGKDVEEPFTRGYQRGREHYQQLCDEDTKAA* |
| Ga0066903_1047562921 | 3300005764 | Tropical Forest Soil | MEFDQVSAAMDAALEDVKQQYPGSNVEEPFVRGYQRGREHYQQLCDEHRQAA* |
| Ga0080026_100270003 | 3300005952 | Permafrost Soil | RQHPGEDVEEAFTRGYQRGRDYYQQLCDENKRAA* |
| Ga0070717_105769722 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DQVSAEMEATLEDVRRQFPGENVEEPFTRGYQRGREHYQKLCDEAPKAA* |
| Ga0070717_116316911 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FDQISAEMDAALQDVERQFPGKDVEEPFIRGYQRGREHYQQLCDEGTKAA* |
| Ga0075017_1016182822 | 3300006059 | Watersheds | LEDVKRQYPGHNVEEPFTQGYQRGREHYQQLCDEGKRAA* |
| Ga0070765_1020063941 | 3300006176 | Soil | QHQYPGIDLEEAFTTGYQRGREYYQRVCDESQKAA* |
| Ga0073928_111433221 | 3300006893 | Iron-Sulfur Acid Spring | CMEFDQVSGEMNAALEDVQRENPGVDVEEAFTRGYQRGRDHYQQLCDQDKKAA* |
| Ga0105248_103038092 | 3300009177 | Switchgrass Rhizosphere | LEDVQRQYPNAKVEEPFTRGYQRGREYYQQLCDESKAA* |
| Ga0116221_13226481 | 3300009523 | Peatlands Soil | VSAAMDAALEDVQREHPGAEVEEAFTRGYQRGREYYQRLCDETSKAA* |
| Ga0105249_104601571 | 3300009553 | Switchgrass Rhizosphere | DVQRQYPNAKVEEPFTRGYQRGREYYQQLCDESKAA* |
| Ga0126374_107989532 | 3300009792 | Tropical Forest Soil | LEDIEHRFPGKDVEEPFTRGYQRGREHYQQLCDEGSKAA* |
| Ga0126373_129195472 | 3300010048 | Tropical Forest Soil | DVQRRFPGKNVEEPFTRGYQRGREHYQQLCDENKRAA* |
| Ga0126370_107931031 | 3300010358 | Tropical Forest Soil | MDAVLEDVKRQHPGASVEGPFTRGYQRGREYYQRTCDENPKAA* |
| Ga0126378_110867172 | 3300010361 | Tropical Forest Soil | FDQISAEMDAALEDVERQFPGKDVEEPFIRGYQRGREHYQQLCDEGTKAA* |
| Ga0126378_124929591 | 3300010361 | Tropical Forest Soil | EFDQVSTAMNSALEDVERQYPGEQVEEPFTRGYRRGREHYQSLCDEGERKAS* |
| Ga0137776_17938243 | 3300010937 | Sediment | SAAMDAALEDVQREHPGKEVEEAFTRGYQRGREYYQQRCEETKKAA* |
| Ga0137393_115850671 | 3300011271 | Vadose Zone Soil | LEDLKRQYPDVDVAEPYTRGYQRGRSYYQQLCQGSKAA* |
| Ga0137363_117575282 | 3300012202 | Vadose Zone Soil | SDLEELERQHPGAEVADPFTRGYQRGREYYQRLCEEEKAA* |
| Ga0137377_111483112 | 3300012211 | Vadose Zone Soil | EFDQVSSAMSAALEDVQRQYPGAEVEEAFTQGYQRGRDYYQRLCDENKRAA* |
| Ga0137366_104598162 | 3300012354 | Vadose Zone Soil | FDQVSAAMTAALEDVQRDHPGKDVEAAFIRGYERGREHYQRLCDEGKRAA* |
| Ga0150984_1109899123 | 3300012469 | Avena Fatua Rhizosphere | EMNAALEDAQEQYPGANVEEPFTRGYRRGREHYQTLCEQSKAA* |
| Ga0137359_102943461 | 3300012923 | Vadose Zone Soil | DVKAQYPGANVEEPFLAGYQRGREHYQQLCDETEQLVRE* |
| Ga0181523_101972603 | 3300014165 | Bog | MDAALEDVQRQHPGAEVEEPFTRGYQRGREYYQRLCDQTKKAA* |
| Ga0157377_101357381 | 3300014745 | Miscanthus Rhizosphere | KEFDQVSAEMSATLEDVQRQYPNAKVEEPFTRGYQRGREYYQQLCDESKAA* |
| Ga0182033_100515741 | 3300016319 | Soil | AEMDSQLEDLERQYPDTDIEEPFTRGYRRGREYFQALCDERAA |
| Ga0187847_102919261 | 3300017948 | Peatland | SRLEDLQRQYPKLDVEKPFTRGYQRGRDYYQRLCNESKAA |
| Ga0187781_100904111 | 3300017972 | Tropical Peatland | KLEDLEEQYPGAQIEEPFTRGYQRGREHFQALCDERAA |
| Ga0187816_101894461 | 3300017995 | Freshwater Sediment | VQQKYPGTAVEEPFTRGYQRGREHYQQLCDEKSKAA |
| Ga0187804_101059052 | 3300018006 | Freshwater Sediment | FDQVSGEMNAALEDVQRQFPGAQVEEPFTRGYQRGREHYQRLCDENKAA |
| Ga0187766_108475142 | 3300018058 | Tropical Peatland | MDSRLEDLERQYPDTDIEEPFTRGYRRGREYFQALCDERAA |
| Ga0187784_1001306510 | 3300018062 | Tropical Peatland | DQVSAEMDATLEDAQERFPGVDIEEPFTRGYQRGREHYQQLCDERNKAA |
| Ga0066669_104257992 | 3300018482 | Grasslands Soil | MAATLEDVQRQYPDAKVEEPFTRGYQRGRKYYQQLCDESKAA |
| Ga0206352_103021001 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | ATLEDVQRQYPNAKVEEPFTRGYQRGREYYQQLCDESKAA |
| Ga0210407_103752902 | 3300020579 | Soil | AQREHPGVQLEAAFTRGYQRGRDYYQQRCDETGKAA |
| Ga0210403_100225146 | 3300020580 | Soil | DAALEDVQREHPGAEVEEAFTRGYQRGREYYQRLCDETRKAA |
| Ga0210399_100882463 | 3300020581 | Soil | LEDVQSRYPGKQVEEPFTRGYRRGREHYQQLCDENKKAA |
| Ga0210395_111064892 | 3300020582 | Soil | RCVEFDQVSGEMNAALEDAQRQHPGVQLEAAFTRGYQRGRDYYQQRCDETGKAA |
| Ga0210401_102305572 | 3300020583 | Soil | CLEFDQVSGEMNAALEDLQREYPGVDLEEPFTTGYQRGREYYQRVCDESPKAA |
| Ga0210406_110550832 | 3300021168 | Soil | FDQVSGAMNAALEDVQRQHPGAEVESAFTRGYQRGREYYQHLCDDKKAA |
| Ga0210408_111002972 | 3300021178 | Soil | QRQNPGVEVEEAFTRGYQRGRDYYQQLCDENQQAA |
| Ga0210396_106023551 | 3300021180 | Soil | VALDDVKAQYPGANVEEPFLAGYQRGREHYQQLCDETEQLVKE |
| Ga0210388_103289441 | 3300021181 | Soil | MESNLKELQKQYPGVDLEEAYTRGYERGREYYQRLCDERKAA |
| Ga0210393_106915762 | 3300021401 | Soil | VSGEMNAALEDVQAQYPGADVEEPFSRGYQRGREHYQKLCDDKSQAA |
| Ga0210389_115258451 | 3300021404 | Soil | EFDQVSGEMNAALEDVQKQYPDAKVEEPFTRGYQRGREHYQQLCDEGKKAA |
| Ga0210386_100865464 | 3300021406 | Soil | ALEDVQREHPGADVEEPFTHGYQRGREYYQRRCDETSKAA |
| Ga0210383_101527181 | 3300021407 | Soil | EDVQRQYPGAEVEEAFTRGYQRGREHYQQLCDQNSKAA |
| Ga0210384_108430621 | 3300021432 | Soil | NAALDDVKAQYPGANVEEPFLAGYQRGREHYQQLCDETEQLVKE |
| Ga0210384_111846942 | 3300021432 | Soil | SGAMNAALEDVQRQHPGEDGEEAFTRGYQRGRDYYQQLCDENKRAA |
| Ga0210402_102562521 | 3300021478 | Soil | DVQRQHPGEDVEEAFTRGYQRGRDYYQQLCDENKRAA |
| Ga0210402_108652371 | 3300021478 | Soil | VQKEYPDADVEGPFVRGYQRGREHYQQLCDDTKKAA |
| Ga0210409_107201792 | 3300021559 | Soil | LEDVQREHPDAEVEEAFTRGYQRGREYYQRLCDETRKAA |
| Ga0212123_100867194 | 3300022557 | Iron-Sulfur Acid Spring | VSGEMNAALEDVQRENPGMNVEEAFTRGYQRGRDHYQQLCDEKKAA |
| Ga0212123_104327371 | 3300022557 | Iron-Sulfur Acid Spring | NAALEDAQREHPGVQLEAAFTRGYQRGRDYYQQRCDETGKAA |
| Ga0242665_102613321 | 3300022724 | Soil | TRCMEFDQVSGEMNAALEDVQSRYPGKQVEEPFTQGYRRGREHYQQLCDERSRAA |
| Ga0207696_11750352 | 3300025711 | Switchgrass Rhizosphere | EDVQKQYPNVDVSDAFLAGYQRGRDYYQRVCDESKAA |
| Ga0209375_12411221 | 3300026329 | Soil | VSGEMNAALEDVQRQYPGKQVEEPFTRGFRRGREHYQQLCDEQSRAA |
| Ga0209377_13268902 | 3300026334 | Soil | QVSGEMNAALEDVQRQYPGKQVEEPFTRGFRRGREHYQQLCDEQSRAA |
| Ga0209577_101762183 | 3300026552 | Soil | DQVSAEMDASLEDVRRQYPGENVDEPFTRGYQRGREHYQKLCDEAPKAA |
| Ga0208365_10194322 | 3300027070 | Forest Soil | AEMANRVEELEREYPNASVEGPFTRGYQRGREYYQRLCDECRAA |
| Ga0208366_10222701 | 3300027073 | Forest Soil | RVEELEREYPGANVEGPFTRGYQRGREYYQRLCDESRAA |
| Ga0209622_11105741 | 3300027502 | Forest Soil | DVQREHPGVDVEEAFTRGYQRGRDYYQQLCNENKQAA |
| Ga0209525_10822601 | 3300027575 | Forest Soil | FDQVSGAMNAALEDVQRQHPGEDVEEAFTRGYQRGRDYYQQLCDENKRAA |
| Ga0208988_10938191 | 3300027633 | Forest Soil | QISGEMNAALDDVKAQYPGANVEEPFLAGYQRGREHYQQLCDETEQLVRE |
| Ga0209580_106947091 | 3300027842 | Surface Soil | SGEMNAALEDVQSRYPGKQVEEPFTQGYRRGREHYQQLCDERSRAA |
| Ga0209275_100735583 | 3300027884 | Soil | QVSAAMDAALEEVQREHPGGDVEEPFTRGYQRGREYYQRICDETSKAA |
| Ga0209275_102660871 | 3300027884 | Soil | MNAALEDAQREHPGVQLEAAFTRGYQRGRDYYQQRCDETGKAA |
| Ga0268266_112630861 | 3300028379 | Switchgrass Rhizosphere | MNSRLEEVQEQHPGADVSEPFLKGYQRGRDYYQRICEESKAA |
| Ga0308309_106275531 | 3300028906 | Soil | DVKAQYPGANVEEPFLAGYQRGREHYQQLCDETEQLVKE |
| Ga0308309_116161252 | 3300028906 | Soil | QHQYPGIDLEEAFTTGYQRGREYYQRVCDESQKAA |
| Ga0222749_103079111 | 3300029636 | Soil | SAAMNAALEEAQRENPGADVEEAFTRGYQRGREHYQQLCDETKKAA |
| Ga0311371_107217563 | 3300029951 | Palsa | ASGQMNAALEDAQRQHPGVQLEEAFTRGYQRGRDHYQQRCNEAGKAA |
| Ga0302177_100979722 | 3300030053 | Palsa | CLEFDQVSGEMNAALEDVQRQHPGVDLEEPFTTGYQRGREYYQQVCDEGQKAV |
| Ga0265770_11482081 | 3300030878 | Soil | EDVQRQHPGAEVEPAFTRGYQRGREYYQHLCDDKKAA |
| Ga0170834_1010090111 | 3300031057 | Forest Soil | ALEDLQREYPGKDVEAAFTRGYERGREHYQRLCDESKKAA |
| Ga0170823_133878882 | 3300031128 | Forest Soil | AAMDAALEDVQRQHPGKEVEAAFTRGYQRGREHYQQLCDETKKAA |
| Ga0170819_159496612 | 3300031469 | Forest Soil | GAMNAALEDVQREHPGAQVEEPFTRGYERGREYYQRLCDRENAA |
| Ga0310915_112354822 | 3300031573 | Soil | MEFDQVSAEMDSQLEDLERQYPDTDIEEPFTRGYRRGREYFQALCDERAA |
| Ga0318542_104085961 | 3300031668 | Soil | DAALEDVERQFPGKDVEEPFIRGYQRGREHYQQLCDEGTKAA |
| Ga0307476_111483131 | 3300031715 | Hardwood Forest Soil | EMESNLEDLQKQYPNRDVAEPYTRGYRRGRDYYQRLCDESKAA |
| Ga0307474_106145121 | 3300031718 | Hardwood Forest Soil | QRKYPGVDLEEAFTTGYQRGREYYQRVCDEGQKAA |
| Ga0307469_116320722 | 3300031720 | Hardwood Forest Soil | QVSAAMDAALQDVQARYPGKDVEEPFTRGYSRGREHYQQLCDEKKTAA |
| Ga0307477_100726421 | 3300031753 | Hardwood Forest Soil | FDQVSGEMNAALEDVKREHPGEDVEEAFLRGYERGRDYYQQLCDEKKAA |
| Ga0307475_100249806 | 3300031754 | Hardwood Forest Soil | NAALDDVKAHYPGANVEEPFLAGYQRGREHYQQLCDETEQLVKE |
| Ga0307475_113950172 | 3300031754 | Hardwood Forest Soil | LGEMNAALEDVKAQYPGVNVEEPFLAGYQRGREHYQQLCDETEKLVSD |
| Ga0310917_109372182 | 3300031833 | Soil | DLERQYPDSDIEEPFTRGYRRGREYFQALCDERAA |
| Ga0306926_103335333 | 3300031954 | Soil | EMDAALEEVKRQYPGRDVEEPFLQGYQRGREHYQQLCDEDRKAA |
| Ga0306926_125855191 | 3300031954 | Soil | LEDVERQFPGKDVEEPFIRGYQRGREHYQQLCDEGTKAA |
| Ga0307479_117201412 | 3300031962 | Hardwood Forest Soil | VQRQYPGKQVEEPFTRGYRRGREHYQQLCDENKKAA |
| Ga0307470_112341351 | 3300032174 | Hardwood Forest Soil | EMNSSLEDVQKQYPNVDVSDAFLAGYQRGRDYYQRVCDESKAA |
| Ga0348332_103340233 | 3300032515 | Plant Litter | AEMTSKLEDLQREYPGVKIEEPYTRGYQRGREYYQRLCDEKKAA |
| Ga0315742_115579502 | 3300032756 | Forest Soil | EDVQRENPGMNVEEAFTRGYQRGRDHYQQLCDEKKAA |
| Ga0335075_109418582 | 3300032896 | Soil | DLEDVKRQYPGRNVEEPFLRGYQRGREHYQQLCDESKKAA |
| ⦗Top⦘ |