NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105534

Metagenome / Metatranscriptome Family F105534

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105534
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 41 residues
Representative Sequence VSLRRLRLSKGGLTAEQKSAEGILGHDVGKASEALRMPKGGA
Number of Associated Samples 94
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 93.94 %
% of genes near scaffold ends (potentially truncated) 97.00 %
% of genes from short scaffolds (< 2000 bps) 95.00 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(9.000 % of family members)
Environment Ontology (ENVO) Unclassified
(20.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.14%    β-sheet: 0.00%    Coil/Unstructured: 62.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.22
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF13495Phage_int_SAM_4 22.00
PF08388GIIM 3.00
PF00078RVT_1 3.00
PF14319Zn_Tnp_IS91 1.00
PF08448PAS_4 1.00
PF01695IstB_IS21 1.00
PF13366PDDEXK_3 1.00
PF13565HTH_32 1.00
PF0563523S_rRNA_IVP 1.00
PF02371Transposase_20 1.00
PF13592HTH_33 1.00
PF13683rve_3 1.00
PF12704MacB_PCD 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 1.00
COG3547TransposaseMobilome: prophages, transposons [X] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.00 %
UnclassifiedrootN/A40.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10324432Not Available548Open in IMG/M
3300002069|JGIcombinedJ21912_10196838All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300004471|Ga0068965_1243843Not Available679Open in IMG/M
3300005328|Ga0070676_11578650Not Available507Open in IMG/M
3300005332|Ga0066388_108005960Not Available528Open in IMG/M
3300005538|Ga0070731_11065064All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005564|Ga0070664_101443476All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300006041|Ga0075023_100519157Not Available540Open in IMG/M
3300006050|Ga0075028_101052133All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300006057|Ga0075026_101015592Not Available517Open in IMG/M
3300006176|Ga0070765_102260489All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300006845|Ga0075421_100195959All Organisms → cellular organisms → Bacteria2503Open in IMG/M
3300006893|Ga0073928_10646804Not Available742Open in IMG/M
3300006893|Ga0073928_10781896Not Available661Open in IMG/M
3300006949|Ga0075528_10125079All Organisms → cellular organisms → Bacteria → Proteobacteria683Open in IMG/M
3300009089|Ga0099828_11968807Not Available512Open in IMG/M
3300009519|Ga0116108_1147589All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha699Open in IMG/M
3300009700|Ga0116217_10546473All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300009792|Ga0126374_10906379All Organisms → cellular organisms → Bacteria → Proteobacteria684Open in IMG/M
3300009792|Ga0126374_11661326Not Available530Open in IMG/M
3300009839|Ga0116223_10321728All Organisms → cellular organisms → Bacteria → Proteobacteria920Open in IMG/M
3300010046|Ga0126384_11152549Not Available713Open in IMG/M
3300010361|Ga0126378_11804449Not Available696Open in IMG/M
3300010366|Ga0126379_11966929All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech1591687Open in IMG/M
3300010376|Ga0126381_104593152All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300010379|Ga0136449_100717626All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1672Open in IMG/M
3300010379|Ga0136449_101979682Not Available861Open in IMG/M
3300010880|Ga0126350_10208777Not Available515Open in IMG/M
3300011269|Ga0137392_10047700All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter3209Open in IMG/M
3300011269|Ga0137392_10522412All Organisms → cellular organisms → Bacteria → Proteobacteria986Open in IMG/M
3300012046|Ga0136634_10409132Not Available567Open in IMG/M
3300012188|Ga0136618_10491242All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300012349|Ga0137387_10998616All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech1591600Open in IMG/M
3300012378|Ga0134025_1113428Not Available616Open in IMG/M
3300012915|Ga0157302_10218360All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300012948|Ga0126375_11912583All Organisms → cellular organisms → Bacteria → Proteobacteria521Open in IMG/M
3300012971|Ga0126369_11378738All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300013297|Ga0157378_10275392All Organisms → cellular organisms → Bacteria1620Open in IMG/M
3300014497|Ga0182008_10890511Not Available523Open in IMG/M
3300014657|Ga0181522_10349030Not Available881Open in IMG/M
3300014839|Ga0182027_10200608All Organisms → cellular organisms → Bacteria → Acidobacteria2314Open in IMG/M
3300015245|Ga0137409_10405004Not Available1180Open in IMG/M
3300015259|Ga0180085_1243173All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech1591530Open in IMG/M
3300016341|Ga0182035_11808521Not Available553Open in IMG/M
3300017931|Ga0187877_1372120All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech1591541Open in IMG/M
3300018006|Ga0187804_10111905Not Available1129Open in IMG/M
3300018015|Ga0187866_1163374Not Available854Open in IMG/M
3300018024|Ga0187881_10238708All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300018058|Ga0187766_10341986Not Available978Open in IMG/M
3300018060|Ga0187765_11323651All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300018068|Ga0184636_1245201Not Available637Open in IMG/M
3300018429|Ga0190272_12679376Not Available547Open in IMG/M
3300019270|Ga0181512_1530624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens521Open in IMG/M
3300019284|Ga0187797_1505107Not Available500Open in IMG/M
3300019880|Ga0193712_1049224Not Available919Open in IMG/M
3300021559|Ga0210409_10382611All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin60761261Open in IMG/M
3300021560|Ga0126371_10952770All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1001Open in IMG/M
3300021861|Ga0213853_11040829Not Available532Open in IMG/M
3300024330|Ga0137417_1255936All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300025444|Ga0208189_1054424All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300025650|Ga0209385_1221307All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300025854|Ga0209176_10005410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2364Open in IMG/M
3300025934|Ga0207686_11500830Not Available556Open in IMG/M
3300026089|Ga0207648_11363434All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300026118|Ga0207675_101573847Not Available678Open in IMG/M
3300026783|Ga0207778_101618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1632Open in IMG/M
3300026823|Ga0207759_102740Not Available1527Open in IMG/M
3300027039|Ga0207855_1017826All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300027039|Ga0207855_1048032All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium576Open in IMG/M
3300027641|Ga0208827_1035166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31763Open in IMG/M
3300027667|Ga0209009_1043866All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300027678|Ga0209011_1204565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens536Open in IMG/M
(restricted) 3300027799|Ga0233416_10089949All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech15911047Open in IMG/M
(restricted) 3300027856|Ga0255054_10165790All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300029922|Ga0311363_11077465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales694Open in IMG/M
3300029955|Ga0311342_10300880All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1457Open in IMG/M
3300030053|Ga0302177_10441407All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300030506|Ga0302194_10357527Not Available573Open in IMG/M
3300030618|Ga0311354_11921797All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300031022|Ga0138301_1676904Not Available546Open in IMG/M
3300031234|Ga0302325_10475972All Organisms → cellular organisms → Bacteria1900Open in IMG/M
3300031234|Ga0302325_11255358Not Available979Open in IMG/M
3300031259|Ga0302187_10457349All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300031573|Ga0310915_11085951Not Available556Open in IMG/M
3300031720|Ga0307469_12283498All Organisms → cellular organisms → Bacteria → Proteobacteria527Open in IMG/M
3300031740|Ga0307468_101657944Not Available600Open in IMG/M
3300031890|Ga0306925_10396546All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300031954|Ga0306926_12226560All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300032035|Ga0310911_10718829Not Available578Open in IMG/M
3300032075|Ga0310890_10871218All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300032160|Ga0311301_12163392All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium640Open in IMG/M
3300032261|Ga0306920_102419950All Organisms → cellular organisms → Bacteria → Proteobacteria724Open in IMG/M
3300032431|Ga0335395_10323169All Organisms → cellular organisms → Bacteria → Acidobacteria1058Open in IMG/M
3300032783|Ga0335079_11420902All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300032893|Ga0335069_11407540All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium754Open in IMG/M
3300033402|Ga0326728_10968635All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech1591593Open in IMG/M
3300033433|Ga0326726_11236612All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300033475|Ga0310811_10628110Not Available1068Open in IMG/M
3300034643|Ga0370545_168576Not Available511Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.00%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.00%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.00%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.00%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.00%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring2.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.00%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.00%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.00%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.00%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.00%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.00%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.00%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300002069Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010)EnvironmentalOpen in IMG/M
3300004471Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006949Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16BEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012046Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)EnvironmentalOpen in IMG/M
3300012188Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06)EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012378Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019880Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1EnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025650Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes)EnvironmentalOpen in IMG/M
3300025854Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026783Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 36 (SPAdes)EnvironmentalOpen in IMG/M
3300026823Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes)EnvironmentalOpen in IMG/M
3300027039Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027799 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MGEnvironmentalOpen in IMG/M
3300027856 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23EnvironmentalOpen in IMG/M
3300027865 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031022Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032431Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (spades assembly)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1032443213300001356Peatlands SoilRRLRLSKGGLTAEQKSAEGIVGHVVGKAREALRMPKGGVNR*
JGIcombinedJ21912_1019683813300002069Arctic Peat SoilVSLGRLRLSKGGLTAEQKSAEGILGHDVGKASEALRKP
Ga0068965_124384323300004471Peatlands SoilSVSLRRLREPRGNLTTEQKSAEGVLDHVVGKASEALQEPKGGVNG*
Ga0070676_1157865023300005328Miscanthus RhizosphereVLLRRLRLSEGSLTAEQKSAEGVVDREVGKASEALRMPKGGAMDRP
Ga0066388_10800596013300005332Tropical Forest SoilVSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRKLKGGAM
Ga0070731_1106506413300005538Surface SoilVSLRRLRSLKDGLTAEQKSAEGILGHDVGKASEALRMPKGGAMDR
Ga0070664_10144347613300005564Corn RhizosphereVSLRRLRLSKGGLTAGQKSAEGIVGHDVGKASEALRMPKGGAM
Ga0075023_10051915723300006041WatershedsVSLRRLRLSKGSLTAGQKSAEGILGHDVGKASEAL
Ga0075028_10105213313300006050WatershedsVSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRMPKGGATDRPS
Ga0075026_10101559213300006057WatershedsVSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRRPKGGAMDR
Ga0070765_10226048923300006176SoilVSLRRLKLSKGSLTAGQKSAEGVVGHDVGKASEALRKPKG
Ga0075421_10019595943300006845Populus RhizosphereVSLRRLRLSKGGLTAEQKSAEGILGHDVGKAFEALRNAERRSNG*
Ga0073928_1064680413300006893Iron-Sulfur Acid SpringVSLRRLRLPKGGLTAGQKSAEGILGQAVGKASETL
Ga0073928_1078189613300006893Iron-Sulfur Acid SpringVSLRRLRLPRGILTAGQKSAEGILGYVVGKASEALRKPKDGVNG*
Ga0075528_1012507923300006949Arctic Peat SoilVSHRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRMPKGGATDRPS
Ga0099828_1196880713300009089Vadose Zone SoilVSVNGLRLSKGGLTAGQKSAEGIVGHDVGEASEALRMPKGGAMD
Ga0116108_114758923300009519PeatlandVSFRRLRLPQGSLTAGQKSAEGIVGHVVGKAIEAL
Ga0116217_1054647313300009700Peatlands SoilVSVKGLRLSKGNLTAGQKSAEGIVGHDVGEASEALRKPK
Ga0126374_1090637923300009792Tropical Forest SoilVSLRRLRLSKGGLTAEQKSAEGILGHDVGKASEALRMPKGGA
Ga0126374_1166132613300009792Tropical Forest SoilVSFNGLRLSKGGLTAGQKSAEGILGHDVGEASEALRKP
Ga0116223_1032172823300009839Peatlands SoilVSLRRLRLSRGNLTAGQKSAEGILGHDVGKASEALRKPKG
Ga0126384_1115254913300010046Tropical Forest SoilVSLRRLRLSKGSLTAGQKSAEGILGHDVGKVSEALRRPKGGAM
Ga0126378_1180444913300010361Tropical Forest SoilVSRKRLRRPKGSLTAEQKSAEGILGPAVGKANEALQRRKAE
Ga0126379_1196692913300010366Tropical Forest SoilVSLQRLRLPRGILTAGQKSAEGILGHDVGKASEALRRPKGGAMD
Ga0126381_10459315213300010376Tropical Forest SoilVSLRRLRLSRGSLTAGQKSAEGKVGHVVGKVSEAL
Ga0136449_10071762613300010379Peatlands SoilVSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRKPK
Ga0136449_10197968213300010379Peatlands SoilRLRLSRGILTAGQKSASGILGHVVGKASEALREPKGGVYG*
Ga0126350_1020877713300010880Boreal Forest SoilVSLRRLRLSKGGLTAEQKSAEGILGHDVGKDSEALRKPKGG
Ga0137392_1004770013300011269Vadose Zone SoilVSLRRLRLSKGILTAEQKSAEGIVGHDVGKASEALRMPKG
Ga0137392_1052241213300011269Vadose Zone SoilVSLRRLRLSRGSLTAGQKSAEGIVGHVVGKVSEALR
Ga0136634_1040913223300012046Polar Desert SandVSRRRLRPSKGGLTAEQKSAEGIVGHDVGKASEALRIPKGGAI
Ga0136618_1049124213300012188Polar Desert SandVSPWRLRLSKGSPTAEQKSAEGILGHDVGKASEALRMPK
Ga0137387_1099861613300012349Vadose Zone SoilVSLRRLRLSKGGLTAEQKSAEGILGHDVGKASEALRIPK
Ga0134025_111342813300012378Grasslands SoilVSLRRLRLSKGGLTAGQKSAEGILGHDVGKASETLQMPKGGAM
Ga0157302_1021836023300012915SoilVSLRRLRLPKDGLTAEQKSAEGILGYAVGKASEALQ
Ga0126375_1191258313300012948Tropical Forest SoilVSLRRLRLSKGDLTAGQKSAEGILGHDVGKASEALRMPKGGAMD
Ga0126369_1137873813300012971Tropical Forest SoilVSLRRLRLSRGSLTAEQKSAEGVVGHDVGKVSEALRKPKGGAMDRPS
Ga0157378_1027539233300013297Miscanthus RhizosphereVSVNGLRLSKGGLTTEQKSAEGILGHEVGEASEALQCRKAE
Ga0182008_1089051113300014497RhizosphereVSRKRLRLPKGNLTAGQKSAEGIVGYAVGKASEALQSRK
Ga0181522_1034903023300014657BogVSLRRLRLSRDGLTAEQKSAEGIVGHDVGKASEALRKPKGGAMDR
Ga0182027_1020060833300014839FenVSRRRLRLSKGGLTAGQKSAEGIVGHDVGKASEALRKPKG
Ga0137409_1040500423300015245Vadose Zone SoilVSLRRLRLSRGNLSAGQKSAEGIVGHDVGEASEALRNR
Ga0180085_124317313300015259SoilVSLRRLRLSKGGLTAGQKSAEGILGHDVGKASETLRMPKG
Ga0182035_1180852113300016341SoilVSPRRLRLSRGSLTAEQKAAEGIVGHDVGKVSEAL
Ga0187877_137212013300017931PeatlandVSLRRLRLSRGSLTAGQKSAEGILGHDVGKASEALRMPK
Ga0187804_1011190513300018006Freshwater SedimentVSLRRLRWSKGDLTAGQKSAEGIVGHDVGKASEALRKPKGGAM
Ga0187866_116337413300018015PeatlandVSLRRLRLSKDGLTAEQKSAEGIVGHVVGKVSEALRNRK
Ga0187881_1023870823300018024PeatlandVSLRRLRRPRGSLTAGQKSAEGIVGHDVGKASEAL
Ga0187766_1034198613300018058Tropical PeatlandVSLRRLRAPRGGLTAEQKSADGIVGHAVGKASEALRHRKVE
Ga0187765_1132365113300018060Tropical PeatlandVSLRRLRLSKGDLTAEQKSAEGVVGHDVGKASEALQMPKGGAMDRP
Ga0184636_124520113300018068Groundwater SedimentGLRLSRGSLTAGQKSAEGVLGYVVGEASEALRKPKGGVNG
Ga0190272_1267937613300018429SoilVSPRRLRPSNGGLTAVQKSAEGVVGHDVGKASEALQQPKGGATD
Ga0181512_153062413300019270PeatlandVSLRRLRLSKGGLTAEQKSAEGVVGHVVGDASEALQCREA
Ga0187797_150510723300019284PeatlandVSLRRLRLSKGGLTAGQKSAEGKVGHDVGKASEALRKPKGGAM
Ga0193712_104922423300019880SoilVSLRRLRLSQGGLTAGQKSAEGILGHDVGKASEALRKPKGGA
Ga0210409_1038261113300021559SoilVSLRRLRLSKGGLIAGQKSAEGIVGHDVGKASEALRKPNGGA
Ga0126371_1095277023300021560Tropical Forest SoilVSLRRLRLSKGGLTAEQKSAEGILGHDVGKASEAL
Ga0213853_1104082913300021861WatershedsVSRKRLRLPKGGLTAGQKSAEGVLGHDVGKASEALRCRKAESTDR
Ga0137417_125593623300024330Vadose Zone SoilVSLRRLRAPRGGLIAEQKSAEGIVGHAVGKASEALRNRKVESTD
Ga0208189_105442413300025444PeatlandVSVYGLRLSKGSLTAEQKSAEGILGHDVGKASEALRMPKGGA
Ga0209385_122130713300025650Arctic Peat SoilVSVNGLRLSKGGLTAEQKSAEGILGHDVGKASEALRK
Ga0209176_1000541033300025854Arctic Peat SoilVSHRRLRLSKGGLTAGQKSAEGILGHDVGKASEAL
Ga0207686_1150083013300025934Miscanthus RhizosphereVSPRRLRSLKDGLTAEQKSAEGILGHDVGKASEAL
Ga0207648_1136343423300026089Miscanthus RhizosphereVSLRRLRLSKGGPTAGQKSAKGILGHDVGKASEALRNPKGGVMDR
Ga0207675_10157384713300026118Switchgrass RhizosphereVSLRRLRLSKGDLTAGQKSAEGILGHDVGKASEALRMPKGGATDRSS
Ga0207778_10161813300026783Tropical Forest SoilVSLLRLRQPRGGLTAGQKSAEGIIGHGVGKASEALR
Ga0207759_10274013300026823Tropical Forest SoilVSLQRLRLPKGNLTAEQKSAEGIVVHDVGKASEALRMPKG
Ga0207855_101782613300027039Tropical Forest SoilVSLRRLRLSEGSLTAEQKSAEGILGHDVGKASEALRMPKGGAMDRP
Ga0207855_104803223300027039Tropical Forest SoilVSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRMPKGGAMDR
Ga0208827_103516633300027641Peatlands SoilVSLRRLRLSKGGLTAEQKSAEGIVGHVVGKAREALRMPKGGVNR
Ga0209009_104386633300027667Forest SoilVSANGLRLSKGGLTAEQKSAEGIVGHDVGKASKEPISNRW
Ga0209011_120456513300027678Forest SoilVSLRRLRLSKGGLTAEQKSAEGVVGHDVGKASEALRISKG
(restricted) Ga0233416_1008994913300027799SedimentVSLRRLRLSKGDLTAEQKSAEGVLGHDVGEASEALRQPKGGDHG
(restricted) Ga0255054_1016579023300027856SeawaterQEICPVSLRRLRLSRGSLTAGQKSAEGVLGHDAGKASEALRMPKGGVNR
(restricted) Ga0255052_1055638423300027865SeawaterRLSRGSLTAGQKSAEGVLGHDAGKASEALRMPKGGVNR
Ga0311363_1107746513300029922FenVSLRRLRLPKGGLTAGQKSAEGIVGYAVGKASEVLQCRKAE
Ga0311342_1030088013300029955BogVSLRRLRLPKGGLTAGQKSAEGIVGYAVGKASEVLQ
Ga0302177_1044140723300030053PalsaVSLRRLRLSKGGLTAEQKSAEGIVGHDVGKASEALRKPKGGAMDRP
Ga0302194_1035752723300030506BogVSFRRLRLPQGSLTAGQKSAEGIVGHVVGKAIEALQSRKVE
Ga0311354_1192179713300030618PalsaVSLRRLRLSKGGLIAGQKSAEGVLGHDVGKVSEALQKPKGGAMDRP
Ga0138301_167690413300031022SoilLSKGGLIAEQKSAEGILRHDVGKASEALRMPKGGAMDRPSRKR
Ga0302325_1047597213300031234PalsaVSLRRLRLSKGGLTAEQKSAEGIVGHDVGKASEALRKPKG
Ga0302325_1125535823300031234PalsaVSLRRLRLSKGGLTAEQKSAEGIVGHDVGKASEALRKPKGGAMD
Ga0302187_1045734913300031259BogVSLRRLRLSKSSLTAEQKSAEGILGHDVGKASEALRKPKGGA
Ga0310915_1108595113300031573SoilVSLRRLRLSRGSLTAQQKAAEGIVGHDVGKVSEALRMPKGGA
Ga0307469_1228349813300031720Hardwood Forest SoilVSLRRLRRSRGSLTAGQKSAEGIVGHVVGKVSEALEQPTRL
Ga0307468_10165794423300031740Hardwood Forest SoilVSLRRLRLSKGGLTAGQKSAEGIVGHDVGKASEALRMPKGGA
Ga0306925_1039654613300031890SoilVSLRRLRLSRGSLTAVQKSAEGIAGHDDVGKVSEALEQPTRL
Ga0306926_1222656013300031954SoilVSLRRLRLSQGGLTAEQKSAEGIVGHDVGKASEALRKPKGGAMD
Ga0310911_1071882913300032035SoilVSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEAL
Ga0310890_1087121813300032075SoilVSLRRLRLSKGGLTAEQKSAEGILGHDVGKVREALQCRKAEQ
Ga0311301_1216339223300032160Peatlands SoilVSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRKPKGGAM
Ga0306920_10241995013300032261SoilVSLRRLRLSRGSLTAEQKAAEGIVGHDVGKASEALATEKGVN
Ga0335395_1032316913300032431FreshwaterVSPRRLRLSKGSLTAEQKSAEGVLDREVGKASEALRKPKGGAMDRP
Ga0335079_1142090213300032783SoilVSLRRLRLSKGGLTAEQKSAEGILGHDVGKVSEALRMPK
Ga0335069_1140754013300032893SoilVSLRRLRLSKGGLTAVQKSAEGIVGHDVGKASEALRMPKGGAM
Ga0326728_1096863513300033402Peat SoilVSLRRLRLSRGGLTAGQKSAEGILGHDVGKASEALRK
Ga0326726_1123661213300033433Peat SoilVSPRRLRLSKGSLTAEQKSAEGILGHDVGKASEALRM
Ga0310811_1062811013300033475SoilVSLPRLRLPKGDLTAGQKSAEGILGHDVGEASEALRKPKGG
Ga0370545_168576_398_5113300034643SoilMSSRRLRLSKGGLTAGQKSAEGIVGQDVGKASEALHTP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.