| Basic Information | |
|---|---|
| Family ID | F105534 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VSLRRLRLSKGGLTAEQKSAEGILGHDVGKASEALRMPKGGA |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.94 % |
| % of genes near scaffold ends (potentially truncated) | 97.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.00 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF13495 | Phage_int_SAM_4 | 22.00 |
| PF08388 | GIIM | 3.00 |
| PF00078 | RVT_1 | 3.00 |
| PF14319 | Zn_Tnp_IS91 | 1.00 |
| PF08448 | PAS_4 | 1.00 |
| PF01695 | IstB_IS21 | 1.00 |
| PF13366 | PDDEXK_3 | 1.00 |
| PF13565 | HTH_32 | 1.00 |
| PF05635 | 23S_rRNA_IVP | 1.00 |
| PF02371 | Transposase_20 | 1.00 |
| PF13592 | HTH_33 | 1.00 |
| PF13683 | rve_3 | 1.00 |
| PF12704 | MacB_PCD | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 1.00 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.00 % |
| Unclassified | root | N/A | 40.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10324432 | Not Available | 548 | Open in IMG/M |
| 3300002069|JGIcombinedJ21912_10196838 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300004471|Ga0068965_1243843 | Not Available | 679 | Open in IMG/M |
| 3300005328|Ga0070676_11578650 | Not Available | 507 | Open in IMG/M |
| 3300005332|Ga0066388_108005960 | Not Available | 528 | Open in IMG/M |
| 3300005538|Ga0070731_11065064 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005564|Ga0070664_101443476 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006041|Ga0075023_100519157 | Not Available | 540 | Open in IMG/M |
| 3300006050|Ga0075028_101052133 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300006057|Ga0075026_101015592 | Not Available | 517 | Open in IMG/M |
| 3300006176|Ga0070765_102260489 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006845|Ga0075421_100195959 | All Organisms → cellular organisms → Bacteria | 2503 | Open in IMG/M |
| 3300006893|Ga0073928_10646804 | Not Available | 742 | Open in IMG/M |
| 3300006893|Ga0073928_10781896 | Not Available | 661 | Open in IMG/M |
| 3300006949|Ga0075528_10125079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 683 | Open in IMG/M |
| 3300009089|Ga0099828_11968807 | Not Available | 512 | Open in IMG/M |
| 3300009519|Ga0116108_1147589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 699 | Open in IMG/M |
| 3300009700|Ga0116217_10546473 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300009792|Ga0126374_10906379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 684 | Open in IMG/M |
| 3300009792|Ga0126374_11661326 | Not Available | 530 | Open in IMG/M |
| 3300009839|Ga0116223_10321728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
| 3300010046|Ga0126384_11152549 | Not Available | 713 | Open in IMG/M |
| 3300010361|Ga0126378_11804449 | Not Available | 696 | Open in IMG/M |
| 3300010366|Ga0126379_11966929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech1591 | 687 | Open in IMG/M |
| 3300010376|Ga0126381_104593152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300010379|Ga0136449_100717626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1672 | Open in IMG/M |
| 3300010379|Ga0136449_101979682 | Not Available | 861 | Open in IMG/M |
| 3300010880|Ga0126350_10208777 | Not Available | 515 | Open in IMG/M |
| 3300011269|Ga0137392_10047700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 3209 | Open in IMG/M |
| 3300011269|Ga0137392_10522412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 986 | Open in IMG/M |
| 3300012046|Ga0136634_10409132 | Not Available | 567 | Open in IMG/M |
| 3300012188|Ga0136618_10491242 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012349|Ga0137387_10998616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech1591 | 600 | Open in IMG/M |
| 3300012378|Ga0134025_1113428 | Not Available | 616 | Open in IMG/M |
| 3300012915|Ga0157302_10218360 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300012948|Ga0126375_11912583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300012971|Ga0126369_11378738 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300013297|Ga0157378_10275392 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300014497|Ga0182008_10890511 | Not Available | 523 | Open in IMG/M |
| 3300014657|Ga0181522_10349030 | Not Available | 881 | Open in IMG/M |
| 3300014839|Ga0182027_10200608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2314 | Open in IMG/M |
| 3300015245|Ga0137409_10405004 | Not Available | 1180 | Open in IMG/M |
| 3300015259|Ga0180085_1243173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech1591 | 530 | Open in IMG/M |
| 3300016341|Ga0182035_11808521 | Not Available | 553 | Open in IMG/M |
| 3300017931|Ga0187877_1372120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech1591 | 541 | Open in IMG/M |
| 3300018006|Ga0187804_10111905 | Not Available | 1129 | Open in IMG/M |
| 3300018015|Ga0187866_1163374 | Not Available | 854 | Open in IMG/M |
| 3300018024|Ga0187881_10238708 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300018058|Ga0187766_10341986 | Not Available | 978 | Open in IMG/M |
| 3300018060|Ga0187765_11323651 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300018068|Ga0184636_1245201 | Not Available | 637 | Open in IMG/M |
| 3300018429|Ga0190272_12679376 | Not Available | 547 | Open in IMG/M |
| 3300019270|Ga0181512_1530624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 521 | Open in IMG/M |
| 3300019284|Ga0187797_1505107 | Not Available | 500 | Open in IMG/M |
| 3300019880|Ga0193712_1049224 | Not Available | 919 | Open in IMG/M |
| 3300021559|Ga0210409_10382611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1261 | Open in IMG/M |
| 3300021560|Ga0126371_10952770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1001 | Open in IMG/M |
| 3300021861|Ga0213853_11040829 | Not Available | 532 | Open in IMG/M |
| 3300024330|Ga0137417_1255936 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300025444|Ga0208189_1054424 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300025650|Ga0209385_1221307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300025854|Ga0209176_10005410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2364 | Open in IMG/M |
| 3300025934|Ga0207686_11500830 | Not Available | 556 | Open in IMG/M |
| 3300026089|Ga0207648_11363434 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300026118|Ga0207675_101573847 | Not Available | 678 | Open in IMG/M |
| 3300026783|Ga0207778_101618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1632 | Open in IMG/M |
| 3300026823|Ga0207759_102740 | Not Available | 1527 | Open in IMG/M |
| 3300027039|Ga0207855_1017826 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300027039|Ga0207855_1048032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 576 | Open in IMG/M |
| 3300027641|Ga0208827_1035166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1763 | Open in IMG/M |
| 3300027667|Ga0209009_1043866 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300027678|Ga0209011_1204565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 536 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10089949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech1591 | 1047 | Open in IMG/M |
| (restricted) 3300027856|Ga0255054_10165790 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300029922|Ga0311363_11077465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 694 | Open in IMG/M |
| 3300029955|Ga0311342_10300880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1457 | Open in IMG/M |
| 3300030053|Ga0302177_10441407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300030506|Ga0302194_10357527 | Not Available | 573 | Open in IMG/M |
| 3300030618|Ga0311354_11921797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300031022|Ga0138301_1676904 | Not Available | 546 | Open in IMG/M |
| 3300031234|Ga0302325_10475972 | All Organisms → cellular organisms → Bacteria | 1900 | Open in IMG/M |
| 3300031234|Ga0302325_11255358 | Not Available | 979 | Open in IMG/M |
| 3300031259|Ga0302187_10457349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300031573|Ga0310915_11085951 | Not Available | 556 | Open in IMG/M |
| 3300031720|Ga0307469_12283498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300031740|Ga0307468_101657944 | Not Available | 600 | Open in IMG/M |
| 3300031890|Ga0306925_10396546 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300031954|Ga0306926_12226560 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300032035|Ga0310911_10718829 | Not Available | 578 | Open in IMG/M |
| 3300032075|Ga0310890_10871218 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300032160|Ga0311301_12163392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 640 | Open in IMG/M |
| 3300032261|Ga0306920_102419950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 724 | Open in IMG/M |
| 3300032431|Ga0335395_10323169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300032783|Ga0335079_11420902 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300032893|Ga0335069_11407540 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 754 | Open in IMG/M |
| 3300033402|Ga0326728_10968635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Pectobacteriaceae → Dickeya → Dickeya chrysanthemi → Dickeya chrysanthemi Ech1591 | 593 | Open in IMG/M |
| 3300033433|Ga0326726_11236612 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300033475|Ga0310811_10628110 | Not Available | 1068 | Open in IMG/M |
| 3300034643|Ga0370545_168576 | Not Available | 511 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.00% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.00% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.00% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 2.00% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.00% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.00% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.00% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.00% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.00% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002069 | Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300004471 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012188 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025854 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026783 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 36 (SPAdes) | Environmental | Open in IMG/M |
| 3300026823 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032431 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_103244321 | 3300001356 | Peatlands Soil | RRLRLSKGGLTAEQKSAEGIVGHVVGKAREALRMPKGGVNR* |
| JGIcombinedJ21912_101968381 | 3300002069 | Arctic Peat Soil | VSLGRLRLSKGGLTAEQKSAEGILGHDVGKASEALRKP |
| Ga0068965_12438432 | 3300004471 | Peatlands Soil | SVSLRRLREPRGNLTTEQKSAEGVLDHVVGKASEALQEPKGGVNG* |
| Ga0070676_115786502 | 3300005328 | Miscanthus Rhizosphere | VLLRRLRLSEGSLTAEQKSAEGVVDREVGKASEALRMPKGGAMDRP |
| Ga0066388_1080059601 | 3300005332 | Tropical Forest Soil | VSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRKLKGGAM |
| Ga0070731_110650641 | 3300005538 | Surface Soil | VSLRRLRSLKDGLTAEQKSAEGILGHDVGKASEALRMPKGGAMDR |
| Ga0070664_1014434761 | 3300005564 | Corn Rhizosphere | VSLRRLRLSKGGLTAGQKSAEGIVGHDVGKASEALRMPKGGAM |
| Ga0075023_1005191572 | 3300006041 | Watersheds | VSLRRLRLSKGSLTAGQKSAEGILGHDVGKASEAL |
| Ga0075028_1010521331 | 3300006050 | Watersheds | VSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRMPKGGATDRPS |
| Ga0075026_1010155921 | 3300006057 | Watersheds | VSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRRPKGGAMDR |
| Ga0070765_1022604892 | 3300006176 | Soil | VSLRRLKLSKGSLTAGQKSAEGVVGHDVGKASEALRKPKG |
| Ga0075421_1001959594 | 3300006845 | Populus Rhizosphere | VSLRRLRLSKGGLTAEQKSAEGILGHDVGKAFEALRNAERRSNG* |
| Ga0073928_106468041 | 3300006893 | Iron-Sulfur Acid Spring | VSLRRLRLPKGGLTAGQKSAEGILGQAVGKASETL |
| Ga0073928_107818961 | 3300006893 | Iron-Sulfur Acid Spring | VSLRRLRLPRGILTAGQKSAEGILGYVVGKASEALRKPKDGVNG* |
| Ga0075528_101250792 | 3300006949 | Arctic Peat Soil | VSHRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRMPKGGATDRPS |
| Ga0099828_119688071 | 3300009089 | Vadose Zone Soil | VSVNGLRLSKGGLTAGQKSAEGIVGHDVGEASEALRMPKGGAMD |
| Ga0116108_11475892 | 3300009519 | Peatland | VSFRRLRLPQGSLTAGQKSAEGIVGHVVGKAIEAL |
| Ga0116217_105464731 | 3300009700 | Peatlands Soil | VSVKGLRLSKGNLTAGQKSAEGIVGHDVGEASEALRKPK |
| Ga0126374_109063792 | 3300009792 | Tropical Forest Soil | VSLRRLRLSKGGLTAEQKSAEGILGHDVGKASEALRMPKGGA |
| Ga0126374_116613261 | 3300009792 | Tropical Forest Soil | VSFNGLRLSKGGLTAGQKSAEGILGHDVGEASEALRKP |
| Ga0116223_103217282 | 3300009839 | Peatlands Soil | VSLRRLRLSRGNLTAGQKSAEGILGHDVGKASEALRKPKG |
| Ga0126384_111525491 | 3300010046 | Tropical Forest Soil | VSLRRLRLSKGSLTAGQKSAEGILGHDVGKVSEALRRPKGGAM |
| Ga0126378_118044491 | 3300010361 | Tropical Forest Soil | VSRKRLRRPKGSLTAEQKSAEGILGPAVGKANEALQRRKAE |
| Ga0126379_119669291 | 3300010366 | Tropical Forest Soil | VSLQRLRLPRGILTAGQKSAEGILGHDVGKASEALRRPKGGAMD |
| Ga0126381_1045931521 | 3300010376 | Tropical Forest Soil | VSLRRLRLSRGSLTAGQKSAEGKVGHVVGKVSEAL |
| Ga0136449_1007176261 | 3300010379 | Peatlands Soil | VSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRKPK |
| Ga0136449_1019796821 | 3300010379 | Peatlands Soil | RLRLSRGILTAGQKSASGILGHVVGKASEALREPKGGVYG* |
| Ga0126350_102087771 | 3300010880 | Boreal Forest Soil | VSLRRLRLSKGGLTAEQKSAEGILGHDVGKDSEALRKPKGG |
| Ga0137392_100477001 | 3300011269 | Vadose Zone Soil | VSLRRLRLSKGILTAEQKSAEGIVGHDVGKASEALRMPKG |
| Ga0137392_105224121 | 3300011269 | Vadose Zone Soil | VSLRRLRLSRGSLTAGQKSAEGIVGHVVGKVSEALR |
| Ga0136634_104091322 | 3300012046 | Polar Desert Sand | VSRRRLRPSKGGLTAEQKSAEGIVGHDVGKASEALRIPKGGAI |
| Ga0136618_104912421 | 3300012188 | Polar Desert Sand | VSPWRLRLSKGSPTAEQKSAEGILGHDVGKASEALRMPK |
| Ga0137387_109986161 | 3300012349 | Vadose Zone Soil | VSLRRLRLSKGGLTAEQKSAEGILGHDVGKASEALRIPK |
| Ga0134025_11134281 | 3300012378 | Grasslands Soil | VSLRRLRLSKGGLTAGQKSAEGILGHDVGKASETLQMPKGGAM |
| Ga0157302_102183602 | 3300012915 | Soil | VSLRRLRLPKDGLTAEQKSAEGILGYAVGKASEALQ |
| Ga0126375_119125831 | 3300012948 | Tropical Forest Soil | VSLRRLRLSKGDLTAGQKSAEGILGHDVGKASEALRMPKGGAMD |
| Ga0126369_113787381 | 3300012971 | Tropical Forest Soil | VSLRRLRLSRGSLTAEQKSAEGVVGHDVGKVSEALRKPKGGAMDRPS |
| Ga0157378_102753923 | 3300013297 | Miscanthus Rhizosphere | VSVNGLRLSKGGLTTEQKSAEGILGHEVGEASEALQCRKAE |
| Ga0182008_108905111 | 3300014497 | Rhizosphere | VSRKRLRLPKGNLTAGQKSAEGIVGYAVGKASEALQSRK |
| Ga0181522_103490302 | 3300014657 | Bog | VSLRRLRLSRDGLTAEQKSAEGIVGHDVGKASEALRKPKGGAMDR |
| Ga0182027_102006083 | 3300014839 | Fen | VSRRRLRLSKGGLTAGQKSAEGIVGHDVGKASEALRKPKG |
| Ga0137409_104050042 | 3300015245 | Vadose Zone Soil | VSLRRLRLSRGNLSAGQKSAEGIVGHDVGEASEALRNR |
| Ga0180085_12431731 | 3300015259 | Soil | VSLRRLRLSKGGLTAGQKSAEGILGHDVGKASETLRMPKG |
| Ga0182035_118085211 | 3300016341 | Soil | VSPRRLRLSRGSLTAEQKAAEGIVGHDVGKVSEAL |
| Ga0187877_13721201 | 3300017931 | Peatland | VSLRRLRLSRGSLTAGQKSAEGILGHDVGKASEALRMPK |
| Ga0187804_101119051 | 3300018006 | Freshwater Sediment | VSLRRLRWSKGDLTAGQKSAEGIVGHDVGKASEALRKPKGGAM |
| Ga0187866_11633741 | 3300018015 | Peatland | VSLRRLRLSKDGLTAEQKSAEGIVGHVVGKVSEALRNRK |
| Ga0187881_102387082 | 3300018024 | Peatland | VSLRRLRRPRGSLTAGQKSAEGIVGHDVGKASEAL |
| Ga0187766_103419861 | 3300018058 | Tropical Peatland | VSLRRLRAPRGGLTAEQKSADGIVGHAVGKASEALRHRKVE |
| Ga0187765_113236511 | 3300018060 | Tropical Peatland | VSLRRLRLSKGDLTAEQKSAEGVVGHDVGKASEALQMPKGGAMDRP |
| Ga0184636_12452011 | 3300018068 | Groundwater Sediment | GLRLSRGSLTAGQKSAEGVLGYVVGEASEALRKPKGGVNG |
| Ga0190272_126793761 | 3300018429 | Soil | VSPRRLRPSNGGLTAVQKSAEGVVGHDVGKASEALQQPKGGATD |
| Ga0181512_15306241 | 3300019270 | Peatland | VSLRRLRLSKGGLTAEQKSAEGVVGHVVGDASEALQCREA |
| Ga0187797_15051072 | 3300019284 | Peatland | VSLRRLRLSKGGLTAGQKSAEGKVGHDVGKASEALRKPKGGAM |
| Ga0193712_10492242 | 3300019880 | Soil | VSLRRLRLSQGGLTAGQKSAEGILGHDVGKASEALRKPKGGA |
| Ga0210409_103826111 | 3300021559 | Soil | VSLRRLRLSKGGLIAGQKSAEGIVGHDVGKASEALRKPNGGA |
| Ga0126371_109527702 | 3300021560 | Tropical Forest Soil | VSLRRLRLSKGGLTAEQKSAEGILGHDVGKASEAL |
| Ga0213853_110408291 | 3300021861 | Watersheds | VSRKRLRLPKGGLTAGQKSAEGVLGHDVGKASEALRCRKAESTDR |
| Ga0137417_12559362 | 3300024330 | Vadose Zone Soil | VSLRRLRAPRGGLIAEQKSAEGIVGHAVGKASEALRNRKVESTD |
| Ga0208189_10544241 | 3300025444 | Peatland | VSVYGLRLSKGSLTAEQKSAEGILGHDVGKASEALRMPKGGA |
| Ga0209385_12213071 | 3300025650 | Arctic Peat Soil | VSVNGLRLSKGGLTAEQKSAEGILGHDVGKASEALRK |
| Ga0209176_100054103 | 3300025854 | Arctic Peat Soil | VSHRRLRLSKGGLTAGQKSAEGILGHDVGKASEAL |
| Ga0207686_115008301 | 3300025934 | Miscanthus Rhizosphere | VSPRRLRSLKDGLTAEQKSAEGILGHDVGKASEAL |
| Ga0207648_113634342 | 3300026089 | Miscanthus Rhizosphere | VSLRRLRLSKGGPTAGQKSAKGILGHDVGKASEALRNPKGGVMDR |
| Ga0207675_1015738471 | 3300026118 | Switchgrass Rhizosphere | VSLRRLRLSKGDLTAGQKSAEGILGHDVGKASEALRMPKGGATDRSS |
| Ga0207778_1016181 | 3300026783 | Tropical Forest Soil | VSLLRLRQPRGGLTAGQKSAEGIIGHGVGKASEALR |
| Ga0207759_1027401 | 3300026823 | Tropical Forest Soil | VSLQRLRLPKGNLTAEQKSAEGIVVHDVGKASEALRMPKG |
| Ga0207855_10178261 | 3300027039 | Tropical Forest Soil | VSLRRLRLSEGSLTAEQKSAEGILGHDVGKASEALRMPKGGAMDRP |
| Ga0207855_10480322 | 3300027039 | Tropical Forest Soil | VSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRMPKGGAMDR |
| Ga0208827_10351663 | 3300027641 | Peatlands Soil | VSLRRLRLSKGGLTAEQKSAEGIVGHVVGKAREALRMPKGGVNR |
| Ga0209009_10438663 | 3300027667 | Forest Soil | VSANGLRLSKGGLTAEQKSAEGIVGHDVGKASKEPISNRW |
| Ga0209011_12045651 | 3300027678 | Forest Soil | VSLRRLRLSKGGLTAEQKSAEGVVGHDVGKASEALRISKG |
| (restricted) Ga0233416_100899491 | 3300027799 | Sediment | VSLRRLRLSKGDLTAEQKSAEGVLGHDVGEASEALRQPKGGDHG |
| (restricted) Ga0255054_101657902 | 3300027856 | Seawater | QEICPVSLRRLRLSRGSLTAGQKSAEGVLGHDAGKASEALRMPKGGVNR |
| (restricted) Ga0255052_105563842 | 3300027865 | Seawater | RLSRGSLTAGQKSAEGVLGHDAGKASEALRMPKGGVNR |
| Ga0311363_110774651 | 3300029922 | Fen | VSLRRLRLPKGGLTAGQKSAEGIVGYAVGKASEVLQCRKAE |
| Ga0311342_103008801 | 3300029955 | Bog | VSLRRLRLPKGGLTAGQKSAEGIVGYAVGKASEVLQ |
| Ga0302177_104414072 | 3300030053 | Palsa | VSLRRLRLSKGGLTAEQKSAEGIVGHDVGKASEALRKPKGGAMDRP |
| Ga0302194_103575272 | 3300030506 | Bog | VSFRRLRLPQGSLTAGQKSAEGIVGHVVGKAIEALQSRKVE |
| Ga0311354_119217971 | 3300030618 | Palsa | VSLRRLRLSKGGLIAGQKSAEGVLGHDVGKVSEALQKPKGGAMDRP |
| Ga0138301_16769041 | 3300031022 | Soil | LSKGGLIAEQKSAEGILRHDVGKASEALRMPKGGAMDRPSRKR |
| Ga0302325_104759721 | 3300031234 | Palsa | VSLRRLRLSKGGLTAEQKSAEGIVGHDVGKASEALRKPKG |
| Ga0302325_112553582 | 3300031234 | Palsa | VSLRRLRLSKGGLTAEQKSAEGIVGHDVGKASEALRKPKGGAMD |
| Ga0302187_104573491 | 3300031259 | Bog | VSLRRLRLSKSSLTAEQKSAEGILGHDVGKASEALRKPKGGA |
| Ga0310915_110859511 | 3300031573 | Soil | VSLRRLRLSRGSLTAQQKAAEGIVGHDVGKVSEALRMPKGGA |
| Ga0307469_122834981 | 3300031720 | Hardwood Forest Soil | VSLRRLRRSRGSLTAGQKSAEGIVGHVVGKVSEALEQPTRL |
| Ga0307468_1016579442 | 3300031740 | Hardwood Forest Soil | VSLRRLRLSKGGLTAGQKSAEGIVGHDVGKASEALRMPKGGA |
| Ga0306925_103965461 | 3300031890 | Soil | VSLRRLRLSRGSLTAVQKSAEGIAGHDDVGKVSEALEQPTRL |
| Ga0306926_122265601 | 3300031954 | Soil | VSLRRLRLSQGGLTAEQKSAEGIVGHDVGKASEALRKPKGGAMD |
| Ga0310911_107188291 | 3300032035 | Soil | VSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEAL |
| Ga0310890_108712181 | 3300032075 | Soil | VSLRRLRLSKGGLTAEQKSAEGILGHDVGKVREALQCRKAEQ |
| Ga0311301_121633922 | 3300032160 | Peatlands Soil | VSLRRLRLSKGGLTAGQKSAEGILGHDVGKASEALRKPKGGAM |
| Ga0306920_1024199501 | 3300032261 | Soil | VSLRRLRLSRGSLTAEQKAAEGIVGHDVGKASEALATEKGVN |
| Ga0335395_103231691 | 3300032431 | Freshwater | VSPRRLRLSKGSLTAEQKSAEGVLDREVGKASEALRKPKGGAMDRP |
| Ga0335079_114209021 | 3300032783 | Soil | VSLRRLRLSKGGLTAEQKSAEGILGHDVGKVSEALRMPK |
| Ga0335069_114075401 | 3300032893 | Soil | VSLRRLRLSKGGLTAVQKSAEGIVGHDVGKASEALRMPKGGAM |
| Ga0326728_109686351 | 3300033402 | Peat Soil | VSLRRLRLSRGGLTAGQKSAEGILGHDVGKASEALRK |
| Ga0326726_112366121 | 3300033433 | Peat Soil | VSPRRLRLSKGSLTAEQKSAEGILGHDVGKASEALRM |
| Ga0310811_106281101 | 3300033475 | Soil | VSLPRLRLPKGDLTAGQKSAEGILGHDVGEASEALRKPKGG |
| Ga0370545_168576_398_511 | 3300034643 | Soil | MSSRRLRLSKGGLTAGQKSAEGIVGQDVGKASEALHTP |
| ⦗Top⦘ |