| Basic Information | |
|---|---|
| Family ID | F105533 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MEYVILIIVIAVLALGTGGWLLFVRPRRGRTLEAPRPQAP |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 97.98 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF02463 | SMC_N | 27.00 |
| PF00933 | Glyco_hydro_3 | 2.00 |
| PF03023 | MurJ | 2.00 |
| PF08281 | Sigma70_r4_2 | 2.00 |
| PF01553 | Acyltransferase | 2.00 |
| PF03602 | Cons_hypoth95 | 1.00 |
| PF01370 | Epimerase | 1.00 |
| PF03793 | PASTA | 1.00 |
| PF02881 | SRP54_N | 1.00 |
| PF04542 | Sigma70_r2 | 1.00 |
| PF12840 | HTH_20 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0534 | Na+-driven multidrug efflux pump, DinF/NorM/MATE family | Defense mechanisms [V] | 2.00 |
| COG0728 | Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis) | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 2.00 |
| COG2244 | Membrane protein involved in the export of O-antigen and teichoic acid | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.00 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.00 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.00 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 1.00 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.00 % |
| All Organisms | root | All Organisms | 28.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS402HFMSS | Not Available | 513 | Open in IMG/M |
| 2199352025|deepsgr__Contig_43313 | Not Available | 769 | Open in IMG/M |
| 3300001356|JGI12269J14319_10223882 | Not Available | 720 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101044908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 702 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10434180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
| 3300005439|Ga0070711_100038072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3231 | Open in IMG/M |
| 3300005921|Ga0070766_11052985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
| 3300006162|Ga0075030_100822299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 733 | Open in IMG/M |
| 3300006176|Ga0070765_102302033 | Not Available | 502 | Open in IMG/M |
| 3300006576|Ga0074047_12037443 | Not Available | 510 | Open in IMG/M |
| 3300006603|Ga0074064_11505182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
| 3300006605|Ga0074057_12240663 | Not Available | 1042 | Open in IMG/M |
| 3300006806|Ga0079220_11637933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 559 | Open in IMG/M |
| 3300009090|Ga0099827_10597648 | Not Available | 951 | Open in IMG/M |
| 3300009672|Ga0116215_1345853 | Not Available | 645 | Open in IMG/M |
| 3300009792|Ga0126374_10582463 | Not Available | 822 | Open in IMG/M |
| 3300010376|Ga0126381_101921907 | Not Available | 853 | Open in IMG/M |
| 3300010379|Ga0136449_100402216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2429 | Open in IMG/M |
| 3300010856|Ga0126358_1061591 | Not Available | 612 | Open in IMG/M |
| 3300010865|Ga0126346_1289419 | Not Available | 697 | Open in IMG/M |
| 3300010869|Ga0126359_1624371 | Not Available | 564 | Open in IMG/M |
| 3300012206|Ga0137380_10719383 | Not Available | 866 | Open in IMG/M |
| 3300012206|Ga0137380_11625433 | Not Available | 530 | Open in IMG/M |
| 3300012209|Ga0137379_10696436 | Not Available | 922 | Open in IMG/M |
| 3300012210|Ga0137378_10587094 | Not Available | 1024 | Open in IMG/M |
| 3300012210|Ga0137378_10885163 | Not Available | 806 | Open in IMG/M |
| 3300012356|Ga0137371_11285017 | Not Available | 542 | Open in IMG/M |
| 3300012478|Ga0157328_1018528 | Not Available | 566 | Open in IMG/M |
| 3300012971|Ga0126369_12087388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 654 | Open in IMG/M |
| 3300015373|Ga0132257_102576531 | Not Available | 661 | Open in IMG/M |
| 3300017999|Ga0187767_10254976 | Not Available | 579 | Open in IMG/M |
| 3300018006|Ga0187804_10355648 | Not Available | 644 | Open in IMG/M |
| 3300018043|Ga0187887_10822778 | Not Available | 549 | Open in IMG/M |
| 3300018060|Ga0187765_11393887 | Not Available | 500 | Open in IMG/M |
| 3300018062|Ga0187784_10053155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 3281 | Open in IMG/M |
| 3300018085|Ga0187772_10136431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1612 | Open in IMG/M |
| 3300018090|Ga0187770_11083283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
| 3300021171|Ga0210405_10695217 | Not Available | 786 | Open in IMG/M |
| 3300021374|Ga0213881_10076667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1432 | Open in IMG/M |
| 3300021401|Ga0210393_11236541 | Not Available | 600 | Open in IMG/M |
| 3300021402|Ga0210385_10390703 | Not Available | 1044 | Open in IMG/M |
| 3300021403|Ga0210397_11079894 | Not Available | 623 | Open in IMG/M |
| 3300021406|Ga0210386_11580548 | Not Available | 545 | Open in IMG/M |
| 3300021478|Ga0210402_11377470 | Not Available | 632 | Open in IMG/M |
| 3300021560|Ga0126371_10724782 | Not Available | 1142 | Open in IMG/M |
| 3300024295|Ga0224556_1105502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 690 | Open in IMG/M |
| 3300024323|Ga0247666_1068996 | Not Available | 707 | Open in IMG/M |
| 3300025634|Ga0208589_1105107 | Not Available | 663 | Open in IMG/M |
| 3300025634|Ga0208589_1132196 | Not Available | 575 | Open in IMG/M |
| 3300025898|Ga0207692_10287505 | Not Available | 997 | Open in IMG/M |
| 3300025906|Ga0207699_11412899 | Not Available | 515 | Open in IMG/M |
| 3300025938|Ga0207704_10479565 | Not Available | 998 | Open in IMG/M |
| 3300025949|Ga0207667_11641991 | Not Available | 611 | Open in IMG/M |
| 3300026515|Ga0257158_1090942 | Not Available | 597 | Open in IMG/M |
| 3300026984|Ga0208732_1008153 | Not Available | 846 | Open in IMG/M |
| 3300026999|Ga0207949_1024476 | Not Available | 557 | Open in IMG/M |
| 3300027158|Ga0208725_1030880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
| 3300027605|Ga0209329_1069625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 759 | Open in IMG/M |
| 3300027698|Ga0209446_1173515 | Not Available | 556 | Open in IMG/M |
| 3300027703|Ga0207862_1013582 | All Organisms → cellular organisms → Bacteria | 2402 | Open in IMG/M |
| 3300027783|Ga0209448_10223757 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300027787|Ga0209074_10323355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → unclassified Paenibacillus → Paenibacillus sp. P22 | 624 | Open in IMG/M |
| 3300027846|Ga0209180_10579602 | Not Available | 622 | Open in IMG/M |
| 3300027884|Ga0209275_10142322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1264 | Open in IMG/M |
| 3300027884|Ga0209275_10338476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 841 | Open in IMG/M |
| 3300027895|Ga0209624_10585728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora | 740 | Open in IMG/M |
| 3300028824|Ga0307310_10634983 | Not Available | 545 | Open in IMG/M |
| 3300028906|Ga0308309_11611137 | Not Available | 552 | Open in IMG/M |
| 3300031546|Ga0318538_10790516 | Not Available | 515 | Open in IMG/M |
| 3300031549|Ga0318571_10177656 | Not Available | 750 | Open in IMG/M |
| 3300031572|Ga0318515_10343884 | Not Available | 800 | Open in IMG/M |
| 3300031573|Ga0310915_10924367 | Not Available | 611 | Open in IMG/M |
| 3300031680|Ga0318574_10417559 | Not Available | 784 | Open in IMG/M |
| 3300031681|Ga0318572_10154650 | Not Available | 1326 | Open in IMG/M |
| 3300031765|Ga0318554_10561324 | Not Available | 644 | Open in IMG/M |
| 3300031770|Ga0318521_10333929 | Not Available | 896 | Open in IMG/M |
| 3300031792|Ga0318529_10519060 | Not Available | 554 | Open in IMG/M |
| 3300031795|Ga0318557_10145806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1068 | Open in IMG/M |
| 3300031797|Ga0318550_10493921 | Not Available | 591 | Open in IMG/M |
| 3300031805|Ga0318497_10369026 | Not Available | 802 | Open in IMG/M |
| 3300031831|Ga0318564_10320734 | Not Available | 682 | Open in IMG/M |
| 3300031835|Ga0318517_10448319 | Not Available | 582 | Open in IMG/M |
| 3300031845|Ga0318511_10013325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2847 | Open in IMG/M |
| 3300031941|Ga0310912_11266901 | Not Available | 560 | Open in IMG/M |
| 3300031942|Ga0310916_11091218 | Not Available | 663 | Open in IMG/M |
| 3300031996|Ga0308176_10226274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1778 | Open in IMG/M |
| 3300032010|Ga0318569_10596248 | Not Available | 514 | Open in IMG/M |
| 3300032025|Ga0318507_10103503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1189 | Open in IMG/M |
| 3300032065|Ga0318513_10046548 | Not Available | 1931 | Open in IMG/M |
| 3300032065|Ga0318513_10340857 | Not Available | 729 | Open in IMG/M |
| 3300032066|Ga0318514_10755345 | Not Available | 517 | Open in IMG/M |
| 3300032076|Ga0306924_11935148 | Not Available | 610 | Open in IMG/M |
| 3300032091|Ga0318577_10556363 | Not Available | 546 | Open in IMG/M |
| 3300032160|Ga0311301_10103041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 5559 | Open in IMG/M |
| 3300032180|Ga0307471_100784929 | Not Available | 1119 | Open in IMG/M |
| 3300032261|Ga0306920_101868618 | Not Available | 845 | Open in IMG/M |
| 3300033289|Ga0310914_10389528 | Not Available | 1261 | Open in IMG/M |
| 3300033290|Ga0318519_10483546 | Not Available | 744 | Open in IMG/M |
| 3300034065|Ga0334827_000407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 22805 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 3.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.00% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010856 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_07308520 | 2189573004 | Grass Soil | MEYVILIIVIAVLAVGAGGWLLFVRPRRGRSLDAPSA |
| deepsgr_00399670 | 2199352025 | Soil | MEYVILIIVIAVLAVATGGWLLFVRPRGGRTLEAPKPQTPPAAQATTTP |
| JGI12269J14319_102238821 | 3300001356 | Peatlands Soil | MEYVILIIVLAVLAVATGGYLLFLRPRPGRHVSGPGQAPQVPPA |
| JGIcombinedJ26739_1010449082 | 3300002245 | Forest Soil | MEYVILIIVIAALAVVTGGWLLFVRPRRGRTSYAPPGQTPAAPTTPAPGG |
| JGIcombinedJ51221_102002731 | 3300003505 | Forest Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRVSAPPSLPTPSAPAEAPAAPSQAEQAA |
| JGIcombinedJ51221_104341801 | 3300003505 | Forest Soil | MEYVILIIVIAVLAVGVGGWLLFLRPRRGRVSAAPRAEVPAPTVAP |
| Ga0070711_1000380721 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MEYVILIIVIAVLALGTGGYLLFMRPGRGRGVAPPPAKPTVTPPASTT |
| Ga0070766_110529852 | 3300005921 | Soil | MEIVILIIVLAVLAVGAGGWLLFLRPRRGRVSAPPSAQAPAPPAAPTGG |
| Ga0075030_1008222991 | 3300006162 | Watersheds | MEYVILIIVIAVLAVAAGGWLLFVRPRSRSVSGPAQAPEVPP |
| Ga0070765_1023020331 | 3300006176 | Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRTLEAPRTQAPVPPATGTETA |
| Ga0074047_120374431 | 3300006576 | Soil | MEYVILIIVLAVLAVGTGSWLLFVRPRRGRTLEAPKPQTPPAAQA |
| Ga0074064_115051822 | 3300006603 | Soil | MEYVILIIVLAVLAVGAGGFLLFVRPRRGRTLEAPKP |
| Ga0074057_122406631 | 3300006605 | Soil | MEYVILIIVLAVLAVGTGSWLLFVRPRRGRTLEAPKPQVPPAAQAT |
| Ga0079220_116379332 | 3300006806 | Agricultural Soil | MEYVILIIVIAVLALVTGGYLLFMRPGRGRTVAPPPA |
| Ga0099827_105976483 | 3300009090 | Vadose Zone Soil | MEYVILIIVIAVLAVGAGGWLLLVRPRRGRTLEAPKSQTPPAAQV |
| Ga0116215_13458531 | 3300009672 | Peatlands Soil | MEYVILIIVIAVLAVVTGGWLLFVRPGRGRHVPGARQAPEVPPAPAAPG |
| Ga0126374_105824632 | 3300009792 | Tropical Forest Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRTLEAPRPQAPVPPATPTTA |
| Ga0126381_1019219071 | 3300010376 | Tropical Forest Soil | MEYVILIIVIAVLAVVAGGWLLFVRPRRGRALQAP |
| Ga0136449_1004022161 | 3300010379 | Peatlands Soil | MEYVILIVVIAVLALAGGGWLLFVRPRRGRAVTAPS |
| Ga0126358_10615912 | 3300010856 | Boreal Forest Soil | MEYVILIIVLAVLAVGTGGWLLFVRPRRGRSLDAPSAQAPTPAPQAT |
| Ga0126346_12894192 | 3300010865 | Boreal Forest Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRVSAPPAAPSLPTTPPSQATAG |
| Ga0126359_16243711 | 3300010869 | Boreal Forest Soil | MEYVILIVVIAVLAVVTGGWLLLVRPRRGRGTIAPPGASRT |
| Ga0137380_107193833 | 3300012206 | Vadose Zone Soil | MEYVILIIVLAVLAVGAGGWLLFVRPGRGRALQAPPAQTPVPPATQATT |
| Ga0137380_116254331 | 3300012206 | Vadose Zone Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRAVGAPRAQAPVEPAATAS |
| Ga0137379_106964363 | 3300012209 | Vadose Zone Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRSVGAPPAQPPVT |
| Ga0137378_105870941 | 3300012210 | Vadose Zone Soil | MEYVILIIVLAVLAVGTGGWLLFVRPRRGRSPDAPSAAAPTTAPQATTIP |
| Ga0137378_108851632 | 3300012210 | Vadose Zone Soil | MEYVILIIVIAVLALGAGGWLLFVRPRRGRSLGGPPAQAPVPPARATTTPA |
| Ga0137371_112850172 | 3300012356 | Vadose Zone Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRAVDAPRAQAPVEPAA |
| Ga0157328_10185282 | 3300012478 | Arabidopsis Rhizosphere | MEYVILIIVIAVLAVGTGGFLLFVRPRRGRTLEAPRS* |
| Ga0126369_120873882 | 3300012971 | Tropical Forest Soil | MAYVILIIVIAVLALVAAGWLLLVRPRLGGRRPAPPS |
| Ga0132257_1025765312 | 3300015373 | Arabidopsis Rhizosphere | MEYVILIIVIAVLAVATGGWLLFVRPRGGRTLEAPKSRTP |
| Ga0187767_102549761 | 3300017999 | Tropical Peatland | MEYVILIIVIAVLAVVAGGWLLFVRPRRGRTIEAPRGQATI |
| Ga0187804_103556481 | 3300018006 | Freshwater Sediment | MEYVILIIVIAVLAVVTGGWLLFVRPRRGRGPAPSGPPPSLP |
| Ga0187887_108227782 | 3300018043 | Peatland | VSLMEYVILIVVIAVLAVVTGGWLLFLRPRRGRGAVAPPSPPPAAP |
| Ga0187765_113938871 | 3300018060 | Tropical Peatland | VSLMEYVILIVVIAVLAVVAGGWLLLVRPRRGRTIEAPRAQAPAPPATGT |
| Ga0187784_100531551 | 3300018062 | Tropical Peatland | MEYVILIVVIAVLAVIGGGWLLFVRPRRGRGVTAPSGPPEA |
| Ga0187772_101364311 | 3300018085 | Tropical Peatland | MEYVILIIVIAILAIVAGGWLLFVRPRRGRVSAPT |
| Ga0187770_110832832 | 3300018090 | Tropical Peatland | MEYVILIIVIAILAIVAGGWLLFVRPRRGRVSAPTGPSAATPPTA |
| Ga0210405_106952172 | 3300021171 | Soil | MEYVILIIVLAVLAVGAGGWLLFVRPRRGRSLDASSAPAPTPAP |
| Ga0213881_100766671 | 3300021374 | Exposed Rock | MEYVILIVVLAVLAVVAGGWLLFLRPRRGRTLEAPPAQ |
| Ga0210393_112365412 | 3300021401 | Soil | MEYVILIIVIAVLAVGAGGYLLFLRPRRGRVSAPS |
| Ga0210385_103907032 | 3300021402 | Soil | VSLMEYVILIIVLAVLAVASGGWLLFVRPRRGRSVSAPGQAPQVPPPP |
| Ga0210397_110798941 | 3300021403 | Soil | MEYVILIIVIAVLALGTGGWLLFQRPRRGRVSAPPAPPS |
| Ga0210386_115805482 | 3300021406 | Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRPVDAPR |
| Ga0210402_113774702 | 3300021478 | Soil | MEYVILIIVLAVLAVGTGSWLLFVRPRRGRSLDAPSTQAP |
| Ga0126371_107247823 | 3300021560 | Tropical Forest Soil | MEYVILIIVIAVLALGAGGWLLFVRPRRGGISAPSPPPTTPS |
| Ga0224556_11055021 | 3300024295 | Soil | MEYVILIVVIAVLAVVTGGWLLFMRPRRGRGAVAPPSPPPAAPG |
| Ga0247666_10689962 | 3300024323 | Soil | MEYVILIIVIAVLAVATGGWLLFVRPRGGRTLEAPKPQTPPA |
| Ga0208589_11051071 | 3300025634 | Arctic Peat Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRVSAPPA |
| Ga0208589_11321961 | 3300025634 | Arctic Peat Soil | VSLMEYVILIVVIAVLAVATGGWLLFVRPGRGRAVKPPA |
| Ga0207692_102875051 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MEYVILIIVIAVLALGAGGWLLFQRPRRGRVAPPATRQV |
| Ga0207699_114128991 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MEYVILIIVIAVLALGAGGWLLFQRPRRGRVAPPATRQVEPTA |
| Ga0207704_104795651 | 3300025938 | Miscanthus Rhizosphere | MEYVILIIVIAVLAVATGGWLLFVRPRRGRSLDAPS |
| Ga0207667_116419912 | 3300025949 | Corn Rhizosphere | MEYVILIIVIAVLAVATGGWLLFVRPRRGRSLDAPSAAAPTAAPQATTT |
| Ga0257158_10909422 | 3300026515 | Soil | MEYVILIIVIAVLALGTGSWLLFVRPRRGRIPTRPAPSSPPTTPSAPAET |
| Ga0208732_10081532 | 3300026984 | Forest Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRVSAPPSLPTPSAPAEA |
| Ga0207949_10244762 | 3300026999 | Forest Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRVSAPPSLPTPSAPAEAPA |
| Ga0208725_10308802 | 3300027158 | Forest Soil | MEYVILIIVIAVLAVGAGGWLLFLRPRRGRVSAPSRAEVPAPT |
| Ga0209329_10696252 | 3300027605 | Forest Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRVSAPPAPSSLPT |
| Ga0209446_11735151 | 3300027698 | Bog Forest Soil | VSLMEYVILIIVIAVLAVAAGGWLLFVRPRGRSVSGPAQAPEVPPAP |
| Ga0207862_10135821 | 3300027703 | Tropical Forest Soil | MEYVILIIVIAVLAVVAGGWLLFVRPRRGRISAPPGHAPGPPAG |
| Ga0209448_102237571 | 3300027783 | Bog Forest Soil | MEYVILIIVIAVLAVIAGGWLLFLRPRRGRGAHAAPGRAPAAP |
| Ga0209074_103233552 | 3300027787 | Agricultural Soil | MEYVILIIVIAVLALVTGGYLLFMRPGRGRTVAPPPARPTVTPPASTTAGS |
| Ga0209180_105796022 | 3300027846 | Vadose Zone Soil | MEYVILIIVLAVLAVLTGGWLLFVRPRRGRASYAPPGQTP |
| Ga0209275_101423221 | 3300027884 | Soil | MEYVILIIVIAVLAVGAGGWLLFLRPRRGRVSAPPSAQAPAPPAAPTGGAEQAAEDTA |
| Ga0209275_103384762 | 3300027884 | Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRVSAPPAPSSLPASSAPA |
| Ga0209624_105857281 | 3300027895 | Forest Soil | MEYVILIIVIAVLLLGGGGYLLFQRPRRGRLQAPS |
| Ga0307310_106349832 | 3300028824 | Soil | MEYVILIIVIAVLAVVTGGWLLFIRPRRGRTLEAPKPQTP |
| Ga0308309_116111372 | 3300028906 | Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRTLEAPRTQAPVPPATGTQTATGP |
| Ga0318538_107905161 | 3300031546 | Soil | MEYVILIIVIAVLALGVGGWLLFVRPRRGRGVSAPPAPPTTPSAPSGQRAP |
| Ga0318571_101776561 | 3300031549 | Soil | MEYVILIIVIAVLAVVAGGWLLFVRPRRGRALQAPPAR |
| Ga0318515_103438842 | 3300031572 | Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRTLEAPRPQAPVPPATETT |
| Ga0310915_109243671 | 3300031573 | Soil | VSLMEYVILIIVIAVLAVVGAGWLLFVRPRHGRGV |
| Ga0318574_104175592 | 3300031680 | Soil | MEYVILIIVIAVLAVVAGGWLLFVRPRRGRALQAPPAPAK |
| Ga0318572_101546503 | 3300031681 | Soil | MEYVILIIVIAVLALGAGGFLLFVRPRRGRTLEAPRPQ |
| Ga0318554_105613242 | 3300031765 | Soil | MEYVILIIVIAVLALGAGGFLLFVRPRRGRTLEAPRPQAPVPPPAG |
| Ga0318521_103339292 | 3300031770 | Soil | MEYVILIIVIAVLAVVAGGWLLFVRPRRGRALQAPPAPAKVPPAGGRC |
| Ga0318529_105190602 | 3300031792 | Soil | MEYVILIVVIAVLALVGAGWLLFVRPRRGRGVSAPSAP |
| Ga0318557_101458062 | 3300031795 | Soil | MEYVILIIVIAVLALVGAGWLLFVRPRRGRGVSAPSAPAPPTTSSGPSG |
| Ga0318550_104939211 | 3300031797 | Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRTLEAPR |
| Ga0318497_103690261 | 3300031805 | Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRTLEAPRPQAPVPPATETTAAP |
| Ga0318564_103207341 | 3300031831 | Soil | MEYVILIVVIAVLALVGAGWLLFVRPRRGRGVSAPSAPAPPTTSS |
| Ga0318517_104483192 | 3300031835 | Soil | MEYVILIIVIAVLALVAGGWLLFVRPRRGRGSAPPGQR |
| Ga0318511_100133251 | 3300031845 | Soil | MEYVILIIVIAVLALVAGGWLLFVRPRRGRGSAPPGQRP |
| Ga0310912_112669012 | 3300031941 | Soil | MEYVILIIVIAVLALGAGGFLLFVRPRRGRTLEAPRPQAPVSPPA |
| Ga0310916_110912182 | 3300031942 | Soil | MEYVILIVVIAVLALVGAGWLLFVRPRRGRGVSAPSAPAPPT |
| Ga0308176_102262741 | 3300031996 | Soil | MEYVILIIVIAVLALGTGGYLLFMRPGRGRTVAPPPAKPTVTPPASTTA |
| Ga0318569_105962482 | 3300032010 | Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRTLEAPRPQAPVPP |
| Ga0318507_101035032 | 3300032025 | Soil | MEYVILIVVIAVLALVGAGWLLFVRPRRGRGVSAPSAPA |
| Ga0318513_100465482 | 3300032065 | Soil | MEYVILIVVIAVLALVGAGWLLFVRPRRGRGVSAPSAPAPPTT |
| Ga0318513_103408571 | 3300032065 | Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRTLEAPRPQAPVPPAP |
| Ga0318514_107553451 | 3300032066 | Soil | MEYVILIIVIAVLAVVAGGWLLFVRPRRGRALQAPPAP |
| Ga0306924_119351482 | 3300032076 | Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRISAPSGPP |
| Ga0318577_105563631 | 3300032091 | Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRTLEAPRPQAPVPPAPATGTE |
| Ga0311301_101030415 | 3300032160 | Peatlands Soil | MEYVILIIVIAVLAVIAGGWLLFMRPRRGRGAHAAPGRAPASA |
| Ga0307471_1007849291 | 3300032180 | Hardwood Forest Soil | MEYVILIIVIAVLAVATGGWLLFVRPRRGRSLDAPSAAAPTAAPQ |
| Ga0306920_1018686182 | 3300032261 | Soil | MEYVILIIVIAVLALGTGGWLLFVSPRRGRTLEAPRPQAPV |
| Ga0310914_103895283 | 3300033289 | Soil | MEYVILIIVIAVLALGTGGWLLFVRPRRGRTLEAPRPQAP |
| Ga0318519_104835463 | 3300033290 | Soil | MEYVILIIVIAVLALGAGGFLLFVRPRRGRTLEAPRPQA |
| Ga0334827_000407_3_137 | 3300034065 | Soil | MEYVILIVVIAVLAVVTGGWLLFMRPRRGRGAVAPPSPPPAAPGA |
| ⦗Top⦘ |