| Basic Information | |
|---|---|
| Family ID | F105514 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MENMNKKPGQGKTPQQYRDSSRFAWYGVVGMIILLIILTLL |
| Number of Associated Samples | 67 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 9.38 % |
| % of genes near scaffold ends (potentially truncated) | 10.00 % |
| % of genes from short scaffolds (< 2000 bps) | 27.00 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (41.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (94.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (96.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.13% β-sheet: 0.00% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF10544 | T5orf172 | 11.00 |
| PF00037 | Fer4 | 1.00 |
| PF00085 | Thioredoxin | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.00 % |
| All Organisms | root | All Organisms | 30.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000929|NpDRAFT_10120337 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1542 | Open in IMG/M |
| 3300001450|JGI24006J15134_10042093 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1927 | Open in IMG/M |
| 3300001450|JGI24006J15134_10051302 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1683 | Open in IMG/M |
| 3300001450|JGI24006J15134_10079762 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1228 | Open in IMG/M |
| 3300001450|JGI24006J15134_10127840 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 866 | Open in IMG/M |
| 3300001450|JGI24006J15134_10201156 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 607 | Open in IMG/M |
| 3300009074|Ga0115549_1110310 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 915 | Open in IMG/M |
| 3300010151|Ga0098061_1142214 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 874 | Open in IMG/M |
| 3300010153|Ga0098059_1164695 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 870 | Open in IMG/M |
| 3300017703|Ga0181367_1006907 | Not Available | 2107 | Open in IMG/M |
| 3300017705|Ga0181372_1007323 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2061 | Open in IMG/M |
| 3300017706|Ga0181377_1031536 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1093 | Open in IMG/M |
| 3300017706|Ga0181377_1051437 | Not Available | 787 | Open in IMG/M |
| 3300017713|Ga0181391_1046019 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1037 | Open in IMG/M |
| 3300017717|Ga0181404_1005695 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 3394 | Open in IMG/M |
| 3300017721|Ga0181373_1031014 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 986 | Open in IMG/M |
| 3300017726|Ga0181381_1109232 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 582 | Open in IMG/M |
| 3300017738|Ga0181428_1142253 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 561 | Open in IMG/M |
| 3300017753|Ga0181407_1017073 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2026 | Open in IMG/M |
| 3300017767|Ga0181406_1155180 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 686 | Open in IMG/M |
| 3300017775|Ga0181432_1005286 | All Organisms → cellular organisms → Bacteria | 2987 | Open in IMG/M |
| 3300020312|Ga0211542_1040124 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 892 | Open in IMG/M |
| 3300020438|Ga0211576_10440978 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 662 | Open in IMG/M |
| 3300020595|Ga0206126_10352913 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 655 | Open in IMG/M |
| 3300021359|Ga0206689_10535404 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 852 | Open in IMG/M |
| 3300021957|Ga0222717_10234279 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1074 | Open in IMG/M |
| 3300022164|Ga0212022_1006319 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1568 | Open in IMG/M |
| 3300024348|Ga0244776_10150923 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1692 | Open in IMG/M |
| 3300025168|Ga0209337_1065451 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300025168|Ga0209337_1093037 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1426 | Open in IMG/M |
| 3300025168|Ga0209337_1194536 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 831 | Open in IMG/M |
| 3300025890|Ga0209631_10160166 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1201 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 41.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 32.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.00% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.00% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.00% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.00% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.00% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300017703 | Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaG | Environmental | Open in IMG/M |
| 3300017704 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaG | Environmental | Open in IMG/M |
| 3300017705 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_08 viral metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021359 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NpDRAFT_101203373 | 3300000929 | Freshwater And Marine | MESMNKKRKFKLGQGKTPQQYTDSTRFAWYGVVGMIILLILMHSC* |
| JGI24006J15134_100420935 | 3300001450 | Marine | MENSNKKFKFTPGQGKTPQQYRDSAKFAWYGVVGMTLLIIL |
| JGI24006J15134_100513024 | 3300001450 | Marine | MANLNKKLRQGKTSHQYTDSTRFAWYGVVGMIILLILVGLLT* |
| JGI24006J15134_100797623 | 3300001450 | Marine | MENSNKKQKQGKTPQQYQDSSLFAWYGIVGMVILLILMSLLS* |
| JGI24006J15134_100843374 | 3300001450 | Marine | MESMNKKPGQGKTPQQYTDSTRFAWYGVVGMVILLFLSTLL* |
| JGI24006J15134_101278403 | 3300001450 | Marine | MNKKSPGQGKTPQQYTDSTRFAWYSVVGMIIVLILMHSC* |
| JGI24006J15134_101451471 | 3300001450 | Marine | MENLNKKQGQGKTPQQYKDSSRLAWYGVVGMIILLILTSLLIGCVTTQPTEKCCGKN |
| JGI24006J15134_102011563 | 3300001450 | Marine | MANMNKKRKFKPGQGKTPQQYTDSTRFAWYGVVGM |
| Ga0075446_100121311 | 3300006190 | Marine | MENLNKKPGQGKTPQQYKDSSRLAWYGVVGMIIILIFLTLL* |
| Ga0075445_102559472 | 3300006193 | Marine | MENLNKKSGQGKTPQQYRDSSMFAWYSVVGMVLLLGLVSSC* |
| Ga0102817_11025482 | 3300007555 | Estuarine | MNKKSPGQGKTPQQYTDSTRLAWYGVVGMIILLTLVGLLT* |
| Ga0098052_11383023 | 3300008050 | Marine | MNKKFPGQGKTPQQYKDSTRFAWYGVVGMTILIILLTLLGGCAT |
| Ga0115549_11103101 | 3300009074 | Pelagic Marine | MNKKSPGQGKTPQQYTDSTRFAWYGVVGMIIVLILMHSC* |
| Ga0114915_12241921 | 3300009428 | Deep Ocean | MANLNKKHKQGKTPQQYKDSSSFAWYGVVGMIIILTLTILMSGCV |
| Ga0115005_111952612 | 3300009432 | Marine | MANLNKKPGQGKTPQQYRDSSRFAWYGVVGMIIILIILTLL* |
| Ga0115556_12153591 | 3300009437 | Pelagic Marine | MNKKHKFKPGQGKTQKQYTDSTRFAWYGVVGMILLV |
| Ga0115001_105358311 | 3300009785 | Marine | MENLNKKRINGKTPQQYRDNSRLAWYGVVGMIIILFLMSLCGCSHKTH |
| Ga0098061_11422144 | 3300010151 | Marine | MANTNKKSPGQGKTPQQYTDSTKFAWYGVVGMIIVLILMHSC* |
| Ga0098059_11646953 | 3300010153 | Marine | MENLNKKPGQGKTPQQYEDSSRFAWYGVVGMIILLILMHSC* |
| Ga0098059_13905972 | 3300010153 | Marine | MNKKRKFKPGQGKTPQQYTDSTRFAWYGVVGMIIVLFLMHSC* |
| Ga0181367_10069072 | 3300017703 | Marine | MENMNNQGKTPQPYKDSTRFAWYGVVGMIIVLILMHSC |
| Ga0181371_10750372 | 3300017704 | Marine | MNKKFNPGQGKTQKQYEDSARFAWYGVVGMIILLILTHSC |
| Ga0181372_10073235 | 3300017705 | Marine | MENLNKKPGQGKTPQQYEDSSRFAWYGVVGMIILLILMHSC |
| Ga0181377_10139614 | 3300017706 | Marine | MESMNKKPGQGKTPQQYRDSSRFAWYGVVGMVILLFLSTLL |
| Ga0181377_10269201 | 3300017706 | Marine | MENLNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLL |
| Ga0181377_10315363 | 3300017706 | Marine | MENMNKKRKFKLGQGKTPQQYTDSTRFAWYGVVGMMILLILMHSC |
| Ga0181377_10514373 | 3300017706 | Marine | MNNQGKRPKQYEDSARFAWYGVVGMMILLILMHSC |
| Ga0181377_10988061 | 3300017706 | Marine | MANLNKKPGQGKTPQQYTDSTRFAWYGVVGMTLLV |
| Ga0181369_10358662 | 3300017708 | Marine | MANSNKKFNPGQGKTPQQYEDSARFAWYGVVGMIVLLILFTLLSSCT |
| Ga0181369_11104531 | 3300017708 | Marine | MANTNKKLPRRGKTPQQYTDSTRFAWYGVVGKDLLVILLSLLGGCATTH |
| Ga0181387_10316152 | 3300017709 | Seawater | MENMNKKPGQGKTPQQYRDSSRFAWYGVIGMVILLILASLL |
| Ga0181403_10187903 | 3300017710 | Seawater | MENMNKKPGQGKTPQQYHDSSRFAWYGVIGMVILLILASLL |
| Ga0181391_10460192 | 3300017713 | Seawater | MNKKRKFKPGQGKTPQQYTDSTRFAWYGVVGMIILLILMHSC |
| Ga0181404_10056956 | 3300017717 | Seawater | MENSNKKRKFKPGQGKTPQQYQDSTKLTWYGVLGMVILLILVMLLT |
| Ga0181390_10165974 | 3300017719 | Seawater | MENSNKKHKFKPGQGKTPQQYQDSTKLAWYGVLGMVILLILVMLLT |
| Ga0181383_11954483 | 3300017720 | Seawater | MNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTQ |
| Ga0181373_10310142 | 3300017721 | Marine | MNKKRKFKPGQGKTPQQYTDSTRFAWYGVVGMIIVLFLMHSC |
| Ga0181388_10697592 | 3300017724 | Seawater | MANLNKKLRQGKTPQQYTDSTRLAWYGVVGMIILLTLVGLLT |
| Ga0181388_10834971 | 3300017724 | Seawater | LNLNQLKHLIYMENSNKKRKFKPGQGKTPQQYQDSTKLAWYGVLGMVILLILVMLLT |
| Ga0181388_11048293 | 3300017724 | Seawater | MENLNKKPGQGKTNKQYRDSSRFAWYGVVGMIILLILMTLLS |
| Ga0181381_11092323 | 3300017726 | Seawater | MANMNKKPGQGKTQQQYTDSTRFAWYGVVGMTLLIILL |
| Ga0181419_10154344 | 3300017728 | Seawater | MENMNKKSSRQGKTPQQYTDSTRFAWYGVVGMTLLV |
| Ga0181417_10395361 | 3300017730 | Seawater | MENLNKKPGQGKTNKQYRDSSRFAWYGVVGMIILLILMHSC |
| Ga0181416_11633291 | 3300017731 | Seawater | MANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVI |
| Ga0181426_10349344 | 3300017733 | Seawater | MENMNKKHKFKPGQGKTQKQYTDSTRFAWYGVVGMILLVILLTLLGGCAT |
| Ga0181431_10071095 | 3300017735 | Seawater | MENMNKKRKFKPGQGKTPQQYTDSTRFAWYGVVGMIILLILMHSC |
| Ga0181431_10586621 | 3300017735 | Seawater | MANMNKKFNPGQGKTQKQYEDSAKFAWYGVVGMVVL |
| Ga0181428_10312124 | 3300017738 | Seawater | NKKRKFKPGQGKTPQQYQDSTKLAWYGVLGMVILLILVMLLT |
| Ga0181428_11422533 | 3300017738 | Seawater | MENMNKKRKFKPGQGKTPQQYTDSTRFAWYGVVGMIILLIL |
| Ga0181402_10367681 | 3300017743 | Seawater | MANMNKKSPGQGKTSQQYTDSTRFAWYGVVGMTLLVI |
| Ga0181402_10593821 | 3300017743 | Seawater | MANMNKKFNPGQGKTEKQYEDSAKFAWYGVVGMIVLLILFTLLSSCTTTKN |
| Ga0181389_10570901 | 3300017746 | Seawater | MANMNKKSPGQGKTPQQYRDSAKFAWYGVVGMIILLVLSSLLMGCTTT |
| Ga0181389_10717963 | 3300017746 | Seawater | MNNQGKRPKQYEDSARFAWYGVVGMIILLILMHSC |
| Ga0181405_10434093 | 3300017750 | Seawater | MANMNKKSPGQGKTSQQYTDSTRFAWYGVVGMTLLVILLSLLGGCATTQ |
| Ga0181407_10170733 | 3300017753 | Seawater | MENSNKKRKFKPGQGKTPQQYQDSTRLAWYGVLGMVILLILVMLLT |
| Ga0181407_10440001 | 3300017753 | Seawater | MENLNNQGKTPQQYKDSTRFAWYGVVGMTLLVILLTLLGGCATTQPTKK |
| Ga0181411_10739831 | 3300017755 | Seawater | MANTNKKRKFKPGQGKTPQQYTDSTRLAWYGVVGMTLLVILLTLLGGCAT |
| Ga0181420_10432832 | 3300017757 | Seawater | MENMNKKHKFKPGQGKTPQQYEDSSRFAWYGVVGMAIILLLVILLGGCATTQPVKK |
| Ga0181420_11709133 | 3300017757 | Seawater | MENSNKKHKFKPGQGKTPQQYQDSTKLAWYGVLGMVILLILV |
| Ga0181420_11907541 | 3300017757 | Seawater | QLKHTIYMENLNNQGKTPQQYTDSTRFAWYGVVGMIILLIILTLL |
| Ga0181420_12287153 | 3300017757 | Seawater | MENMNKKYKFKPGQGKTPQQYTDSTRFAWYGVVGMTLLV |
| Ga0181408_10379263 | 3300017760 | Seawater | MENSNKKRKFKPGQGKTPQQYQDSTKFAWYGVLGMVILLILVMLLT |
| Ga0181410_10696043 | 3300017763 | Seawater | MANMNKKFNPGQGKTEKQYEDSAKFALYGVVGMIVLLILFTLLSSCTTTKK |
| Ga0181413_10225384 | 3300017765 | Seawater | MANMNKKLGQGKTPHQYKDSARFAWDGVVGMVILLILSTLL |
| Ga0181406_11551801 | 3300017767 | Seawater | MNKKPGQGKTPQQYTDSTRFAWYGVVGMIILLILMHSC |
| Ga0181430_12327101 | 3300017772 | Seawater | MANMNKKPGQGKTPQQYHDSSRFAWYGVIGMVILLILASLL |
| Ga0181432_10052863 | 3300017775 | Seawater | MENMNKKIGQGKTHHQYEDSSRFAWYSVVGMIILLILTSLLV |
| Ga0181432_11840643 | 3300017775 | Seawater | MENMNKKPGQGKTQQQYKDSARFAWYGVVGMVILLILVGLLT |
| Ga0181394_10577903 | 3300017776 | Seawater | MENLNKKHKFKPGQGKTPQQYTDSTRFAWYGVVGM |
| Ga0181394_10934973 | 3300017776 | Seawater | MNKKRKFKPGQGKTPQQYTDSTRLAWYGVVGMIILLILMHSC |
| Ga0181395_10738631 | 3300017779 | Seawater | MANMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLSLLG |
| Ga0181379_12964173 | 3300017783 | Seawater | MASMNKKHKFKPGQGKTPQQYEDSARFAWYGVLGMIILLILTSLLTGCVT |
| Ga0211542_10401241 | 3300020312 | Marine | MENTNKKSPGQGKTPQQYTDSTRLAWYGVVGMVLLLILLT |
| Ga0211677_103450221 | 3300020385 | Marine | MANSNKKFNPGQGKTPQQYEDSAKFAWYGVVGMVVLLIFFTLLSSC |
| Ga0211653_104833171 | 3300020421 | Marine | MENMNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILL |
| Ga0211576_104409781 | 3300020438 | Marine | MENSNKKRKFKPGQGKTPQQYQDSTKLAWYGVLGMVILLILVMLLT |
| Ga0211576_105059922 | 3300020438 | Marine | MANMNKKLGQGKTPHQYKDSARFAWYGVVGMVILLILSTLL |
| Ga0206126_103529131 | 3300020595 | Seawater | MNKKFNPGQGKTPQQYEDSARFAWYGVVGMIVLLILFSLLSSCST |
| Ga0206689_105354042 | 3300021359 | Seawater | MNKKRKFKLGQGKTPQQYTDSTRFAWYGVVGMIILLILMHSC |
| Ga0206123_101129841 | 3300021365 | Seawater | MANSNKKFNPGQGKTPQQYEDSAKFAWYGVVGMIVLLILFTLLSS |
| Ga0222717_102342793 | 3300021957 | Estuarine Water | MESMNKKRKFKLGQGKTPQQYTDSTRFAWYGVVGMIILLILMHSC |
| Ga0212022_10063195 | 3300022164 | Aqueous | MANSNKKPNPGQGKTPQQYEDSARFAWYGVVGMVVF |
| (restricted) Ga0233432_101365761 | 3300023109 | Seawater | MANMNKKFNPGQGKTPQQYEDSAKFAWYGVVGMVILLILFSLLSSCTTT |
| (restricted) Ga0233432_104907782 | 3300023109 | Seawater | MENMNKKPGQGKTLQQYRDSSRFAWYGVVGMVILLILASLL |
| Ga0244776_101509235 | 3300024348 | Estuarine | MANMNKKPNIGQGRNKQQYEDSAKAAFYGWCGVLI |
| Ga0208157_10695344 | 3300025086 | Marine | MNKKSPGQGKTPQQYTDSTRFAWYGVVGMTLLVILLTL |
| Ga0209337_10576854 | 3300025168 | Marine | MANLNKKLRQGKTSHQYTDSTRFAWYGVVGMIILLILVGLLT |
| Ga0209337_10591793 | 3300025168 | Marine | MANSNKKPGQGKTPQQYRDSSKFAWYAVVGMLILLFFLSAC |
| Ga0209337_10654513 | 3300025168 | Marine | MENSNKKQKQGKTPQQYQDSSLFAWYGIVGMVILLILMSLLS |
| Ga0209337_10930373 | 3300025168 | Marine | MNKKSPGQGKTPQQYTDSTRFAWYSVVGMIIVLILMHSC |
| Ga0209337_11782491 | 3300025168 | Marine | MANMNKKSRQGKTPQQYRDSSRFAWYGVVGMVLLLI |
| Ga0209337_11945362 | 3300025168 | Marine | MANMNKKRKFKPGQGKTPQQYTDSTRFAWYGVVGMIIVLILMHSY |
| Ga0209337_13347102 | 3300025168 | Marine | MENMNKKPGQGKTPQQYRDSSRFAWYGVVGMIILLIILTLL |
| Ga0208660_11301143 | 3300025570 | Aqueous | MANSNKKPNPGQGKTPQQYEDSARFAWYGVVGMVVLLILFSLLS |
| Ga0209631_101601661 | 3300025890 | Pelagic Marine | MANMNKKFNPGQGKTPQQYEDSARFAWYGVVGMVVLLILFSLLSSCT |
| Ga0209383_11505812 | 3300027672 | Marine | MENLNKKSGQGKTPQQYRDSSMFAWYSVVGMVLLLGLVSSC |
| Ga0209383_11665543 | 3300027672 | Marine | MANMNKKPGQGKTPQQYTDSTRFAWYGVVGMVILLILASLLTGCTGVYYLTDA |
| Ga0256368_10188962 | 3300028125 | Sea-Ice Brine | MENSNKNPGQGKTNKQYRDSAMFAWYGVVGMVILLIILTLL |
| Ga0183755_11066421 | 3300029448 | Marine | MANMNKKSPGQGKTPQQYTDSTRLAWYGVVGMTLLVILLTLLGGCAT |
| Ga0307986_104037733 | 3300031659 | Marine | MENSNKKPGQGKTPQQYRDSSQFAWYGVVGMIILLFVASLLLGCS |
| ⦗Top⦘ |