| Basic Information | |
|---|---|
| Family ID | F105486 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 52 residues |
| Representative Sequence | MTDQQKRARLREILSDPKGAIAPGVTDALFARLVQDCGYAAAHLSGNAIH |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.00 % |
| % of genes from short scaffolds (< 2000 bps) | 96.00 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (17.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (51.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.05% β-sheet: 0.00% Coil/Unstructured: 67.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 61.00 |
| PF12681 | Glyoxalase_2 | 25.00 |
| PF00326 | Peptidase_S9 | 3.00 |
| PF04909 | Amidohydro_2 | 2.00 |
| PF13565 | HTH_32 | 1.00 |
| PF01106 | NifU | 1.00 |
| PF07969 | Amidohydro_3 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101508767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 862 | Open in IMG/M |
| 3300000789|JGI1027J11758_12874830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 839 | Open in IMG/M |
| 3300000789|JGI1027J11758_12917079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300000956|JGI10216J12902_113126242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300003324|soilH2_10237461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1063 | Open in IMG/M |
| 3300003997|Ga0055466_10266062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300004480|Ga0062592_102164908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300004778|Ga0062383_10265425 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300004779|Ga0062380_10046896 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300004782|Ga0062382_10600747 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005289|Ga0065704_10258207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 972 | Open in IMG/M |
| 3300005294|Ga0065705_10306404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1041 | Open in IMG/M |
| 3300005340|Ga0070689_100402560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1157 | Open in IMG/M |
| 3300005347|Ga0070668_102152196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300005356|Ga0070674_102075732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
| 3300005406|Ga0070703_10386057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300005434|Ga0070709_10216052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1365 | Open in IMG/M |
| 3300005471|Ga0070698_101173301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300005577|Ga0068857_101234788 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300005617|Ga0068859_100772969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1049 | Open in IMG/M |
| 3300005764|Ga0066903_104945002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300006049|Ga0075417_10567278 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006194|Ga0075427_10024842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 964 | Open in IMG/M |
| 3300006196|Ga0075422_10230583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 772 | Open in IMG/M |
| 3300006845|Ga0075421_101499337 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300006853|Ga0075420_101295085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300006904|Ga0075424_100069093 | All Organisms → cellular organisms → Bacteria | 3699 | Open in IMG/M |
| 3300006904|Ga0075424_102577202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300006930|Ga0079303_10113690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1032 | Open in IMG/M |
| 3300006969|Ga0075419_10050910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2603 | Open in IMG/M |
| 3300009100|Ga0075418_12003255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300009100|Ga0075418_12716190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300009147|Ga0114129_10241075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2430 | Open in IMG/M |
| 3300009147|Ga0114129_11298737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 902 | Open in IMG/M |
| 3300009147|Ga0114129_11639870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300009147|Ga0114129_12420540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300009156|Ga0111538_11562187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 832 | Open in IMG/M |
| 3300009162|Ga0075423_12338297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300009176|Ga0105242_11340320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 741 | Open in IMG/M |
| 3300009176|Ga0105242_11750528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300010040|Ga0126308_10905805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
| 3300010046|Ga0126384_11091860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300010375|Ga0105239_11841658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300010398|Ga0126383_13651595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300010401|Ga0134121_10631992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1006 | Open in IMG/M |
| 3300011119|Ga0105246_11166013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300011398|Ga0137348_1038531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 793 | Open in IMG/M |
| 3300011435|Ga0137426_1151988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300011436|Ga0137458_1272490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300012041|Ga0137430_1211885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300012201|Ga0137365_11177516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300012212|Ga0150985_110761180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300012484|Ga0157333_1001492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1108 | Open in IMG/M |
| 3300012509|Ga0157334_1018267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 748 | Open in IMG/M |
| 3300012511|Ga0157332_1003926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1209 | Open in IMG/M |
| 3300012532|Ga0137373_10591322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 838 | Open in IMG/M |
| 3300012582|Ga0137358_10996614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300012916|Ga0157310_10185476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300012930|Ga0137407_11045276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300012961|Ga0164302_10918637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300013297|Ga0157378_10725661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1015 | Open in IMG/M |
| 3300014150|Ga0134081_10253073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300014262|Ga0075301_1029634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 971 | Open in IMG/M |
| 3300014326|Ga0157380_12967839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300014864|Ga0180068_1094228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300015252|Ga0180075_1038600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300015372|Ga0132256_102003145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 685 | Open in IMG/M |
| 3300015373|Ga0132257_100335154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1825 | Open in IMG/M |
| 3300015373|Ga0132257_100352161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1780 | Open in IMG/M |
| 3300015373|Ga0132257_103316102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300015374|Ga0132255_105837647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300016319|Ga0182033_10470137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1075 | Open in IMG/M |
| 3300018422|Ga0190265_11259472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300021080|Ga0210382_10355363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 647 | Open in IMG/M |
| 3300022694|Ga0222623_10421534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300025324|Ga0209640_11377352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300025796|Ga0210113_1109045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300025910|Ga0207684_10997456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 701 | Open in IMG/M |
| 3300025912|Ga0207707_10197941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1752 | Open in IMG/M |
| 3300025926|Ga0207659_10982190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300025930|Ga0207701_11155730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300026066|Ga0208290_1038306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300027843|Ga0209798_10515880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300027880|Ga0209481_10128610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1240 | Open in IMG/M |
| 3300028878|Ga0307278_10290159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300028884|Ga0307308_10463757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300031548|Ga0307408_101723002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300031719|Ga0306917_10291285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1259 | Open in IMG/M |
| 3300031720|Ga0307469_10951630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 799 | Open in IMG/M |
| 3300031911|Ga0307412_11505519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300032017|Ga0310899_10450449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300032180|Ga0307471_103688500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300032205|Ga0307472_100538025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1017 | Open in IMG/M |
| 3300032770|Ga0335085_12181720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300033158|Ga0335077_10485657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1309 | Open in IMG/M |
| 3300033412|Ga0310810_10151991 | All Organisms → cellular organisms → Bacteria | 2687 | Open in IMG/M |
| 3300034147|Ga0364925_0237284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 676 | Open in IMG/M |
| 3300034150|Ga0364933_072460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 860 | Open in IMG/M |
| 3300034176|Ga0364931_0162351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 722 | Open in IMG/M |
| 3300034178|Ga0364934_0262209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 655 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 17.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.00% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.00% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 4.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 4.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.00% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.00% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012484 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510 | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014864 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10D | Environmental | Open in IMG/M |
| 3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300026066 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1015087672 | 3300000364 | Soil | MTDLEKRARLREILADPKGAVAPGVTDPIFARLAADCGYSAVHLSGNAIHKSFCLPD |
| JGI1027J11758_128748302 | 3300000789 | Soil | MNDQDKRALLRKIFDDPKGAIAPGITDALFARLAQDCGYKALHLSGNAIHRNFCLPDRNLLTVTQ |
| JGI1027J11758_129170792 | 3300000789 | Soil | MTGRQKRARLREILADPKGDIAPGVTDPMFARLAWRSNAT* |
| JGI10216J12902_1131262422 | 3300000956 | Soil | MTDRQKRARLREIIADPKGDIAPGVTDPMFARLARRSNAT* |
| soilH2_102374611 | 3300003324 | Sugarcane Root And Bulk Soil | MNDQEKRGLLRKIFDDPQGAVAPGITDALFARLAQDCGYKALHLSGNAIHR |
| Ga0055466_102660621 | 3300003997 | Natural And Restored Wetlands | LPITDQQKRSRLREILNDPRGAIAPGITDALFARLSQDCGYSAVHLSGNAIHKNFCLPDRNLLTVTQIA |
| Ga0062592_1021649082 | 3300004480 | Soil | MSDREKRARLREIFAGPKGIIAPGVTDALFAQLAQDCGYA |
| Ga0062383_102654252 | 3300004778 | Wetland Sediment | MNDQQKRALLRKILTGATGAIAPGVTDALFARLAQDCGYAAVHLSGNAIHKNFCLPDRNLLTVTQI |
| Ga0062380_100468963 | 3300004779 | Wetland Sediment | MDDQQKRARLRELLNDPKGAIAPGVTDALFARLAQDCGFSAVHLS |
| Ga0062382_106007472 | 3300004782 | Wetland Sediment | MNDQQKRALLRKILTGATGAIAPGVTDALFARLAQDCGYAAVHLSGNAIHKNFCLPDRNLLTVTQIAQ |
| Ga0065704_102582071 | 3300005289 | Switchgrass Rhizosphere | MTDQQKRARLREILRDGEGAIAPGVTDALFARLVQDCGFPAAHL* |
| Ga0065705_103064041 | 3300005294 | Switchgrass Rhizosphere | MNDQDKRALLRKIFDDPKGAIAPGITDALFARLAQDCGYKALHLSGNAIH |
| Ga0070689_1004025603 | 3300005340 | Switchgrass Rhizosphere | MNDQQKRMRLRELLADPTGAIAPGVTDGLFARLVQDCGYA |
| Ga0070668_1021521961 | 3300005347 | Switchgrass Rhizosphere | MTDQQKRARLREILADPKGAIAPGVTDALFTRLVQDCGYAAAHLSGNAI |
| Ga0070674_1020757322 | 3300005356 | Miscanthus Rhizosphere | MTDQQKRARLRELLADPNGAIAPGVTDALFARLAQDCGYSAVHLSG |
| Ga0070703_103860571 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDQQKRARLREILSDPKGAIAPGVTDALFARLVQDCGYAA |
| Ga0070709_102160521 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDREKRARLRDIFSGPKGIIAPGVTDALFAQLAQDCGYAAVHLSGNAIHKNFCLPDRNLLSVTQIAQ |
| Ga0070698_1011733012 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDQQKRARLREILADNNGAIAPGVTDALFARLVQDCGYAAAHLSG |
| Ga0068857_1012347882 | 3300005577 | Corn Rhizosphere | MRDREKRARLHEIFAGPKGIIAPGVTDALFAQLAQDCGYAAVHLSGNAIHKNFCLPDRNLLSVTQIAQR |
| Ga0068859_1007729692 | 3300005617 | Switchgrass Rhizosphere | MNDQQKRMRLRELLADPTGAIAPGVTDGLFARLVQDCGYAVAHLSGNAIPKTFACGTEISSRRR |
| Ga0066903_1049450022 | 3300005764 | Tropical Forest Soil | MNDREKRAQLREVLGGPNGIIAPGVTDALFARLAQDCGYRAAHLSGNAIHKNF |
| Ga0075417_105672781 | 3300006049 | Populus Rhizosphere | MNDQEKRALLRKIFNDPKGAIAPGITDALFARLAQDCGYRALHLSG |
| Ga0075427_100248422 | 3300006194 | Populus Rhizosphere | MTDRQKRARLREILADSKGAIAPGITDPIFARLAA |
| Ga0075422_102305831 | 3300006196 | Populus Rhizosphere | MNDQEKRALIRKIFGDPQGAIAPAITDALFARLVQDCGYRALHLSGNAIHRNFCLPDRNLLT |
| Ga0075421_1014993371 | 3300006845 | Populus Rhizosphere | MTDQQKRERLRDLLADPNGAIAPGVTDALFARLVQDCGYAAAHLSGNAIHKNFCL |
| Ga0075420_1012950851 | 3300006853 | Populus Rhizosphere | MTDQQKRARLREILTDPNGAIAPGVTDALFARLVQDCGYTAAHL |
| Ga0075424_1000690931 | 3300006904 | Populus Rhizosphere | MTDQQKRARLREILADPKGTIAPGIADALFARLAQDCGYD |
| Ga0075424_1025772021 | 3300006904 | Populus Rhizosphere | MNDRQKRARLREILAGTKGIIAPGVTDALFARLAQDCGYDAVH |
| Ga0079303_101136903 | 3300006930 | Deep Subsurface | MNDQQKRARLRELLGDTKGAIAPGVTDALYARLAQDCGFKAVH |
| Ga0075419_100509101 | 3300006969 | Populus Rhizosphere | MTGRQKRARLREILADPKGDIAPGVTDPMFGRLAADCGYSAVHLSGNAIHKSFCLPDRNLLTVT |
| Ga0075418_120032551 | 3300009100 | Populus Rhizosphere | MTDQQKRARLREILSDPKGAIAPGVTDALFARLVQDCGYAAAHLSGNAIH |
| Ga0075418_127161901 | 3300009100 | Populus Rhizosphere | MNDQEKRALLRKIFNDPKGAIAPGITDALFARLAQDCGYRALHLS |
| Ga0114129_102410754 | 3300009147 | Populus Rhizosphere | MTDRQKRARLREILADSKGAIAPGVTDPMFARLAADCGYS |
| Ga0114129_112987371 | 3300009147 | Populus Rhizosphere | MNDHDKRLRFREILAGTSGVIAPGAAEPLFAKLVQDCGYPAVHASGNAI |
| Ga0114129_116398701 | 3300009147 | Populus Rhizosphere | MTDQQKRERLREILTDPSGAIAPGVTDALFSRLVQDCGYAAAHLSGNAIHKNF |
| Ga0114129_124205401 | 3300009147 | Populus Rhizosphere | MNDHDKRLRFREILGGTSGVIAPGAAEPLFAKLVQDCGYPAVHASGNAIHKHLV |
| Ga0111538_115621872 | 3300009156 | Populus Rhizosphere | VSLLPMNDQEKRALLRKIFGDPQGTIAPGITDALFARLAQDCGYRALHLSGNAIHSNFCLPDRNLLT |
| Ga0075423_123382971 | 3300009162 | Populus Rhizosphere | MNDREKRARLRAVLAGPTGIIAPGVTDALFARLAQDCGYDAVHLSGNAIHKN |
| Ga0105242_113403202 | 3300009176 | Miscanthus Rhizosphere | MNDQDKRELLRKIFDDPKGAIAPGITDALFARLAHDCGYKALHLSGNALHRNFCLLDRNLLTVTQIAQRAAQIAE |
| Ga0105242_117505281 | 3300009176 | Miscanthus Rhizosphere | MNDRQKRARLRELLAGPNGIIAPGVTDALFARLAQDCG |
| Ga0126308_109058051 | 3300010040 | Serpentine Soil | MNDQQKRARLHELLNDLKGVIAPGVTDALFARLAQDCGFSAVHLSGNAIHKNF |
| Ga0126384_110918602 | 3300010046 | Tropical Forest Soil | MTDQQKRVRLREILATPKGDIAPGVINPIFARLAADCGYSAVHLSGNAIHK |
| Ga0105239_118416582 | 3300010375 | Corn Rhizosphere | MRDREKRARLREIFAGPKGIIAPGVTDALFAQLAQDCGYAAVHLSGNAIHKNFCLPDRNLLSV |
| Ga0126383_136515951 | 3300010398 | Tropical Forest Soil | MNDREKRAQLREILGGPNGIIAPGVTDALFARLAQDCGYRAAHLSGNAIHKNF |
| Ga0134121_106319921 | 3300010401 | Terrestrial Soil | MNDREKRARLRDIFSGPKGIIAPGVTDALFAQLAQDCGYAAVHLSGNAIHKNF |
| Ga0105246_111660131 | 3300011119 | Miscanthus Rhizosphere | MNDREKRARLRDIFSGPKGIIAPGVTDALFAQLAQDCGYAAVHLSGNAIHKNFCLPDRNL |
| Ga0137348_10385311 | 3300011398 | Soil | MTDRQKRARLREILADSKGAIAPGVTDPMFARLAADCGYSAVHLS |
| Ga0137426_11519881 | 3300011435 | Soil | MNDQQKRARLRELLGDSKGAIAPGVTDALFALLAQDCG |
| Ga0137458_12724901 | 3300011436 | Soil | MNDQQKRARLRDLLNDPKGAIAPGVTDALFARLAQDCGFNAVHLSGNAIHKNFCL |
| Ga0137430_12118851 | 3300012041 | Soil | MTDQQKRARLREILSDPKGAIAPGVTDALFARLVQDCGY |
| Ga0137365_111775161 | 3300012201 | Vadose Zone Soil | MNDQEKRALLRKVFDDPKGAIAPGITDALFARLAQDCGYKALHLSGNAIHRNFCL |
| Ga0150985_1107611801 | 3300012212 | Avena Fatua Rhizosphere | MNDSDKRARLREILADPSGALAPGVTDALTARLVEDC |
| Ga0157333_10014922 | 3300012484 | Soil | VSLLPMNDQEKRALLRKIFGDPQGAIAPGITDALFARLAQDCGYRALHLSGNAIHRNFCLPDRNLLTVTQIAQRAA |
| Ga0157334_10182671 | 3300012509 | Soil | MSLLPMNDQEKRALLRKIFGDPQGAIAPGITDALFARLAQDCGYRALHLSGNAIHRNFCLPDRNLLTV |
| Ga0157332_10039261 | 3300012511 | Soil | MSDREKRARLREIFAGPKGIIAPGVTDALFAQLAQDCGYAAVHLSGNAIHKNF |
| Ga0137373_105913222 | 3300012532 | Vadose Zone Soil | MTDQQKHARLREILADSKGAIAPGVTDALFARLVQDCGYPAAHLSGNAIHK |
| Ga0137358_109966141 | 3300012582 | Vadose Zone Soil | MNDQDKRALLRKIFDDPKGAIAPGITDALFARLAQDCGYKALHLSGNAI |
| Ga0157310_101854761 | 3300012916 | Soil | MNDRQKRARLRELLAGPNGIIAPGVTDALFARLAQDCGYSA |
| Ga0137407_110452762 | 3300012930 | Vadose Zone Soil | LPTTDQEKRARLHEIFADPKGAIAPGVTDALFARLAQDCGYGAVHLSGNAIHKNFCLPDR |
| Ga0164302_109186372 | 3300012961 | Soil | MNDQDKRALLRKIFDDPKGAIAPGITDALFARLVQDCGYKALHLSG |
| Ga0157378_107256611 | 3300013297 | Miscanthus Rhizosphere | MSLLPMNDQDKRALLRKIFDDPKGAIAPGITDALFARLVQDCGYKALHLSGNAIHRKFCM |
| Ga0134081_102530731 | 3300014150 | Grasslands Soil | MTDQQKRARLREILADSEGAIAPSVTDALFARMVQDCAYPAAHLSGNAIHKNFCLPDRNLLTITQIAQRV |
| Ga0075301_10296342 | 3300014262 | Natural And Restored Wetlands | MTDREKRARLREILNDPKGAIAPGVTDALFARLAQDCGFATAHLSGNAIHKNFCLPD |
| Ga0157380_129678392 | 3300014326 | Switchgrass Rhizosphere | MNDQQKRARLHELLNDPKGVIAPGVTDALFARLAQDCGFSAVHLSGNAIHKNFCLPDRNLLTTTQVAQRLGQI |
| Ga0180068_10942281 | 3300014864 | Soil | MNDQQKRARLRDLLNDPKGAIAPGVTDALFARLVQDCGYG |
| Ga0180075_10386002 | 3300015252 | Soil | MTDGEKRARLRDILADARGTIAPGVTDALFARLVQDCGYGA |
| Ga0132256_1020031451 | 3300015372 | Arabidopsis Rhizosphere | MSLLPMNDQEKRALLRKIFGDPQGAIAPGITDALFARLAQDCGYRALHLSGNAIHRNFCLPDRNLLT |
| Ga0132257_1003351541 | 3300015373 | Arabidopsis Rhizosphere | MRDREKRARLREIFAGPKGIIAPGVTDALFAQLAQDCGYAAVHLSGNAIHKNFCL |
| Ga0132257_1003521611 | 3300015373 | Arabidopsis Rhizosphere | MNDQDKRALLRKIFDDPKGAIAPGITDALFARLVQDCGYRALHLSGNAIHRNFC |
| Ga0132257_1033161021 | 3300015373 | Arabidopsis Rhizosphere | MSDREKRARLREIFAGPKGIIAPGVTDALFAQLAQDCGYAAVHLSGNAIHKNFCL |
| Ga0132255_1058376472 | 3300015374 | Arabidopsis Rhizosphere | MNDQQKRMRLREILSDPTGAIAPGVTDGLFARLVQDCG |
| Ga0182033_104701371 | 3300016319 | Soil | MTDLEKRARLCQILTDPNGAVAPGVTDPIFARLAADCGYSAVHLSGNAIHKSFCLPDRNLLTVTEIASRA |
| Ga0190265_112594722 | 3300018422 | Soil | MTDQQKRARLRDILTSPKGAIAPGVTDGLFARLAQDCGYAAVHLSG |
| Ga0210382_103553632 | 3300021080 | Groundwater Sediment | MTDHQKRSRLREILADTKGAIAPGVTDALFARLVQDC |
| Ga0222623_104215342 | 3300022694 | Groundwater Sediment | MTDRQKRARLREILADSKGAIAPGITDPIFARLAADCGYS |
| Ga0209640_113773521 | 3300025324 | Soil | MTDGEKRARLRDILADARGTIAPGVTDALFARLVQDCDYGAAHLSG |
| Ga0210113_11090452 | 3300025796 | Natural And Restored Wetlands | MSDNRKRIRLREILAASKGAIAPGVTDPMFARLVQDSGYSVIHLSGSAIHKTFCLPDRDL |
| Ga0207684_109974562 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDLEKRARLREILADPKGAVAPGVTNPIFARLAADCGYSAVHLSGNAI |
| Ga0207707_101979411 | 3300025912 | Corn Rhizosphere | MNDQEKRGLLRKIFADPQGAIAPGITDALFARLAQDCGYKALHLSGNAIHRNFC |
| Ga0207659_109821902 | 3300025926 | Miscanthus Rhizosphere | MRDREKRARLREIFAGPKGIIAPGVTDALFAQLAQDCGYAAVHLSGN |
| Ga0207701_111557301 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MHDQQKRTRLREILADPTGAIAPGVTDGLFARLVQDCGYAAAHLSGN |
| Ga0208290_10383061 | 3300026066 | Natural And Restored Wetlands | LPITDQQKRSRLREILNDPRGAIAPGITDALFARLAQDCGYAAVHLSANAMHKNFCLPDRNLLTVTQIGQRVG |
| Ga0209798_105158801 | 3300027843 | Wetland Sediment | MNDQQKRALLRKILTGATGAIAPGVTDALFARLAQDCGYAAVHLS |
| Ga0209481_101286101 | 3300027880 | Populus Rhizosphere | MTGRQKRARLREILADPKGDIAPGVTDPMFGRLAADCGYSAVHLSGNAIHKSFC |
| Ga0307278_102901592 | 3300028878 | Soil | MNDHEKRARLREILADTKGAIAPGVTDALFAHLVQDCGYPAAHLSGNAIHKNFCLPDRHL |
| Ga0307308_104637572 | 3300028884 | Soil | LPTTDQEKRARLHEIFADPKGAIAPGVTDALFARLAQDCGYGAVHLS |
| Ga0307408_1017230021 | 3300031548 | Rhizosphere | MNDQQKRARLHELLNDPKGVIAPGVTDALFARLAQDCGFSAVHLSGNAIHKNFCLPDRNL |
| Ga0306917_102912853 | 3300031719 | Soil | MNDREKRAQLREILGRPNGVIAPGVTDALFARLAQDCGYRAAHLSGNAIHKNFCLPDRN |
| Ga0307469_109516301 | 3300031720 | Hardwood Forest Soil | LLTTDQEKRARLHAIFADPKGAIAPGVTDALFARLAQDCGYGAVHLSGNAIHKNF |
| Ga0307412_115055191 | 3300031911 | Rhizosphere | MNDQQKRARLHELLNDPQGVIAPGVTDALFARLAQDCG |
| Ga0310899_104504491 | 3300032017 | Soil | MTDQQKRARLREVFADPTGAIAPGVTDALFARLAQDCGYAAVHLSGNAIHKNLCL |
| Ga0307471_1036885001 | 3300032180 | Hardwood Forest Soil | MTDRQKRERLRELLSTAGGSIAPGVTDALFARLAQDCGYAV |
| Ga0307472_1005380252 | 3300032205 | Hardwood Forest Soil | MTDQEKRARLREILADPRGAIAPGVTDALFARLSQDCGYDVVHLSGNAIQRNFCLP |
| Ga0335085_121817201 | 3300032770 | Soil | MTDQRKRMRLHEILAHPEGIIAPGVTDALFARLAQDCGYGAVHLSGNAIHKNFCLP |
| Ga0335077_104856573 | 3300033158 | Soil | MTDQSKRARLREILADSEGIIAPGVTDGLFARLAQDCGYGVVHLSGNA |
| Ga0310810_101519914 | 3300033412 | Soil | MNAGEKRARLREILADAGGTVAPGVTDAMTARLVEDCGYAVAHLSGNAIHKNFCRADRNL |
| Ga0364925_0237284_2_166 | 3300034147 | Sediment | MTDQQKRARLREILSDPKGAIAPGVTDALFARLVQDCGYAAAHLSGNAIHKNFCL |
| Ga0364933_072460_2_178 | 3300034150 | Sediment | MNDQDKRALLRKIFDDPKGAIAPGITDALFARLAQDCGYKALHLSGNAIHRNFCLPDRN |
| Ga0364931_0162351_2_151 | 3300034176 | Sediment | MTDRQKRARLREILADSKGAIAPGVTDPMFARLAADCGYSAVHLSGNAIH |
| Ga0364934_0262209_3_212 | 3300034178 | Sediment | MTEREKRARLREILNDPKGAIAPGVTDALFARLAQDCGCAAVHLSGNAIHKNFCLPNRNLLTTTQIAQRI |
| ⦗Top⦘ |