Basic Information | |
---|---|
Family ID | F105446 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 44 residues |
Representative Sequence | TTLLVAITPEYFLFASLAPGALVGRARFALRLAGLALEREFE |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.00 % |
% of genes near scaffold ends (potentially truncated) | 96.00 % |
% of genes from short scaffolds (< 2000 bps) | 95.00 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (59.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (31.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF00364 | Biotin_lipoyl | 48.00 |
PF02786 | CPSase_L_D2 | 10.00 |
PF00289 | Biotin_carb_N | 9.00 |
PF02581 | TMP-TENI | 2.00 |
PF00801 | PKD | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 2.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 59.00 % |
Unclassified | root | N/A | 41.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004024|Ga0055436_10047866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1152 | Open in IMG/M |
3300004030|Ga0055444_10054976 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
3300004048|Ga0055494_10106836 | Not Available | 611 | Open in IMG/M |
3300004091|Ga0062387_100354940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
3300004282|Ga0066599_100741576 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300005186|Ga0066676_10158245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1430 | Open in IMG/M |
3300005332|Ga0066388_106710831 | Not Available | 580 | Open in IMG/M |
3300005335|Ga0070666_11086142 | Not Available | 595 | Open in IMG/M |
3300005345|Ga0070692_10197148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1177 | Open in IMG/M |
3300005353|Ga0070669_101700595 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300005466|Ga0070685_10088780 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
3300005545|Ga0070695_100649720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300005574|Ga0066694_10528325 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300005578|Ga0068854_102052009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300005719|Ga0068861_100065442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2800 | Open in IMG/M |
3300005844|Ga0068862_100223639 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1705 | Open in IMG/M |
3300005844|Ga0068862_102683977 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300006034|Ga0066656_10733987 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300006224|Ga0079037_100253560 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
3300006574|Ga0074056_10926497 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300006845|Ga0075421_100661265 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300006845|Ga0075421_101774456 | Not Available | 665 | Open in IMG/M |
3300006852|Ga0075433_10686649 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300007004|Ga0079218_13235861 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300007004|Ga0079218_13497345 | Not Available | 533 | Open in IMG/M |
3300009038|Ga0099829_10596816 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300009100|Ga0075418_11959094 | Not Available | 638 | Open in IMG/M |
3300009111|Ga0115026_11270699 | Not Available | 603 | Open in IMG/M |
3300009111|Ga0115026_11498095 | Not Available | 561 | Open in IMG/M |
3300009167|Ga0113563_11400251 | Not Available | 821 | Open in IMG/M |
3300009540|Ga0073899_10061926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2943 | Open in IMG/M |
3300009821|Ga0105064_1130369 | Not Available | 532 | Open in IMG/M |
3300010359|Ga0126376_11894719 | Not Available | 636 | Open in IMG/M |
3300010362|Ga0126377_13109161 | Not Available | 536 | Open in IMG/M |
3300010391|Ga0136847_13055362 | Not Available | 789 | Open in IMG/M |
3300010397|Ga0134124_10238713 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
3300010400|Ga0134122_11976514 | Not Available | 621 | Open in IMG/M |
3300010430|Ga0118733_102797537 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300012202|Ga0137363_10900640 | Not Available | 751 | Open in IMG/M |
3300012212|Ga0150985_100988876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300012350|Ga0137372_10295285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
3300012357|Ga0137384_10115921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2238 | Open in IMG/M |
3300012363|Ga0137390_10994640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
3300012683|Ga0137398_11136259 | Not Available | 536 | Open in IMG/M |
3300012893|Ga0157284_10077495 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300012906|Ga0157295_10412228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300012910|Ga0157308_10377755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300012913|Ga0157298_10448258 | Not Available | 505 | Open in IMG/M |
3300012925|Ga0137419_10650246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
3300012960|Ga0164301_11234982 | Not Available | 602 | Open in IMG/M |
3300013306|Ga0163162_13182809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300014315|Ga0075350_1172795 | Not Available | 557 | Open in IMG/M |
3300014325|Ga0163163_12641070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300014326|Ga0157380_10318687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1440 | Open in IMG/M |
3300014326|Ga0157380_12508296 | Not Available | 581 | Open in IMG/M |
3300014326|Ga0157380_13286131 | Not Available | 517 | Open in IMG/M |
3300014874|Ga0180084_1043954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
3300017659|Ga0134083_10438937 | Not Available | 575 | Open in IMG/M |
3300018027|Ga0184605_10238647 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300018029|Ga0187787_10468025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300018053|Ga0184626_10101156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
3300018056|Ga0184623_10207222 | Not Available | 901 | Open in IMG/M |
3300018468|Ga0066662_11031185 | Not Available | 817 | Open in IMG/M |
3300019360|Ga0187894_10169952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
3300019874|Ga0193744_1089291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300021081|Ga0210379_10472267 | Not Available | 557 | Open in IMG/M |
3300025931|Ga0207644_11048302 | Not Available | 685 | Open in IMG/M |
3300025960|Ga0207651_11625492 | Not Available | 582 | Open in IMG/M |
3300025981|Ga0207640_12144364 | Not Available | 507 | Open in IMG/M |
3300026118|Ga0207675_101895619 | Not Available | 615 | Open in IMG/M |
3300026142|Ga0207698_11665105 | Not Available | 653 | Open in IMG/M |
3300026320|Ga0209131_1079014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1778 | Open in IMG/M |
3300026463|Ga0256815_1022153 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300026548|Ga0209161_10554843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300027831|Ga0209797_10257277 | Not Available | 732 | Open in IMG/M |
3300027877|Ga0209293_10095459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
(restricted) 3300027881|Ga0255055_10273199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 915 | Open in IMG/M |
3300028828|Ga0307312_10040878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2738 | Open in IMG/M |
3300028878|Ga0307278_10045342 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
3300030002|Ga0311350_10120733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2309 | Open in IMG/M |
3300030114|Ga0311333_10289947 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300031114|Ga0308187_10365881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300031229|Ga0299913_12143368 | Not Available | 504 | Open in IMG/M |
3300031538|Ga0310888_10182953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
3300031547|Ga0310887_10102618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1420 | Open in IMG/M |
3300031740|Ga0307468_100197258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1357 | Open in IMG/M |
3300031854|Ga0310904_11147565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300031858|Ga0310892_10611893 | Not Available | 739 | Open in IMG/M |
3300031892|Ga0310893_10407136 | Not Available | 597 | Open in IMG/M |
3300032770|Ga0335085_11205707 | Not Available | 804 | Open in IMG/M |
3300033416|Ga0316622_101082758 | Not Available | 937 | Open in IMG/M |
3300033434|Ga0316613_10440235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 880 | Open in IMG/M |
3300033481|Ga0316600_11306655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300033482|Ga0316627_101797925 | Not Available | 630 | Open in IMG/M |
3300033487|Ga0316630_10375297 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
3300033487|Ga0316630_11009131 | Not Available | 728 | Open in IMG/M |
3300033487|Ga0316630_11686229 | Not Available | 576 | Open in IMG/M |
3300033803|Ga0314862_0035349 | Not Available | 1038 | Open in IMG/M |
3300034147|Ga0364925_0101992 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300034690|Ga0364923_0078577 | Not Available | 810 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.00% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 3.00% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.00% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.00% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.00% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.00% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.00% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.00% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 1.00% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 1.00% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.00% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.00% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.00% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.00% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.00% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.00% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004030 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordA_D2 | Environmental | Open in IMG/M |
3300004048 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026463 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS6 | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0055436_100478663 | 3300004024 | Natural And Restored Wetlands | TTLLVAITPEYFLFASLAPGALVGRARFALRLAGLALEREFE* |
Ga0055444_100549763 | 3300004030 | Natural And Restored Wetlands | RELAVVTERMTTLLVAITPEYFLFAALRPGAVVGRARFALRLAGLRLRPEFE* |
Ga0055494_101068361 | 3300004048 | Natural And Restored Wetlands | LLVAITPEYFLFASLARGAIVGRARHALRLAGLALLPEFE* |
Ga0062387_1003549402 | 3300004091 | Bog Forest Soil | LSIVTDQLTALLVAITPEYFIFAGLDPGALTGRARFALRLASFELEKEFA* |
Ga0066599_1007415762 | 3300004282 | Freshwater | STDTGLGALQELTVVSEGMTAVIRAITPEYFLFAAVAPGAILGRVRVALRVGCLELERDFA* |
Ga0066676_101582451 | 3300005186 | Soil | AILVAITGEYFLFAALAPGALAGRARFALRIAGLRLRREFQ* |
Ga0066388_1067108312 | 3300005332 | Tropical Forest Soil | LSIVTEKMTALLTSITAEYFLFAALGPGALTGRARHALRVAGSALEREFE* |
Ga0070666_110861421 | 3300005335 | Switchgrass Rhizosphere | ERMVALLVSITPEYFLFAALAPGAVMGRARFALHSAGLALEREFA* |
Ga0070692_101971481 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | REMCVVTDRMTALLTAITPEYFLFAALGPDALAGRARFALRVAGMTLQPEFV* |
Ga0070669_1017005951 | 3300005353 | Switchgrass Rhizosphere | IVAITSEYFLFAALAPGALMGRARFALRMAGIALEKEFE* |
Ga0070685_100887801 | 3300005466 | Switchgrass Rhizosphere | LVSITPEYFLFAALAPGALMGRARFALHAAGLALEREFA* |
Ga0070695_1006497201 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | ALLVAITPEYFLFAGLAPGALMGRARFALRVAGIALEKEFV* |
Ga0066694_105283251 | 3300005574 | Soil | ELWVVTERLVAILVAITGEYFLFAALAPGALAGRARFALRIAGLRLRRECQ* |
Ga0068854_1020520091 | 3300005578 | Corn Rhizosphere | LTTLLVAITPEYFLFASLAPGAVMGRARFALRLAGLALEREFE* |
Ga0068861_1000654421 | 3300005719 | Switchgrass Rhizosphere | EKMVALLVSITPEYFLFAALAPGAVMGRARFALHSAGLALEREFA* |
Ga0068862_1002236391 | 3300005844 | Switchgrass Rhizosphere | TTLLVAITPEYFLFASLAPGAVMGRARFALRLAGLALEREFE* |
Ga0068862_1026839771 | 3300005844 | Switchgrass Rhizosphere | HELCVVTDRMTALLVAITPEYFLFAALGPDALAGRARFALRLAGAALQPEFV* |
Ga0066656_107339872 | 3300006034 | Soil | MVALLVAITPEYFLFAGLAPGALLGRARFALRLASISLEQEFV* |
Ga0079037_1002535603 | 3300006224 | Freshwater Wetlands | TTERMATLLVAITPEYFLFASLTPGALLGRARFALRLAGLALRKEFE* |
Ga0074056_109264971 | 3300006574 | Soil | VAITPDYFLFASLAPGAVMGRARFALRLAGLALEREFE* |
Ga0075421_1006612651 | 3300006845 | Populus Rhizosphere | TEKMVALLVSITPEYFLFAALAPGALMGRARFALHAAGLALEREFA* |
Ga0075421_1017744561 | 3300006845 | Populus Rhizosphere | GITPEYFLYAAVQPGALVGKARHALRMAGLGLQREFA* |
Ga0075433_106866493 | 3300006852 | Populus Rhizosphere | TTLLVAITPEYFLFASLTPGAVMGRARFALRLAGLALEREFE* |
Ga0079218_132358611 | 3300007004 | Agricultural Soil | IVTDKMVALLVAITPEYYLFAALAPGALTGRARFALRAAGLSLEQEFT* |
Ga0079218_134973451 | 3300007004 | Agricultural Soil | VTEKMVAMLVSITSDYFIFAALAPGAVTGRARYAMRLAGLGLEKEFA* |
Ga0099829_105968162 | 3300009038 | Vadose Zone Soil | PEYFLFAALSPGALTGRARFALRSAGLALEREFA* |
Ga0075418_119590942 | 3300009100 | Populus Rhizosphere | ALLTAITPEYFLFAALSPAVVLGRARFAMRLAGMALEQEFL* |
Ga0115026_112706991 | 3300009111 | Wetland | LLVAITGDYFLFASLAPGAVIGRARYALRLAGLSLRQEFE* |
Ga0115026_114980952 | 3300009111 | Wetland | PEYFLFASLSPGAVMGRARFALRLAGLSLRREFE* |
Ga0113563_114002511 | 3300009167 | Freshwater Wetlands | ERMTTLLVAITPEYFLFASLAPGAVMGRARFALRLASLSLRREFE* |
Ga0073899_100619262 | 3300009540 | Activated Sludge | VTVVTEKMTALMTAITPEYFLFAALAPEAGLGRARYALRVTGLSLENEFA* |
Ga0105064_11303691 | 3300009821 | Groundwater Sand | GELRELSVVTEKMTALLVGITGEYFLFAALSPGAITGRARFALRLAGLALQKEFQ* |
Ga0126376_118947192 | 3300010359 | Tropical Forest Soil | VLVSITPEYFLFAGLAPGALMGRARFALRVAGLALEREFV* |
Ga0126377_131091611 | 3300010362 | Tropical Forest Soil | ALLLGITSEYFLFAALAPGGLTGRARFALRLAGLSLQREFQ* |
Ga0136847_130553623 | 3300010391 | Freshwater Sediment | EKMTAILVGITREYFLFAALAPGALAGRARFAMRVAGLALQREFQ* |
Ga0134124_102387131 | 3300010397 | Terrestrial Soil | VVTEKMVAIIVAITEEYFLFASLAPGALLGRSRFALRMAGIALEKEFE* |
Ga0134122_119765142 | 3300010400 | Terrestrial Soil | AITPDYFIFAGLEPGAVMGRARFALRLAGVALEKEFV* |
Ga0118733_1027975371 | 3300010430 | Marine Sediment | MVTERMNTLLVAITPEYFLFAALRPGAIVGRARFALRLAGLSLREEFE* |
Ga0137363_109006401 | 3300012202 | Vadose Zone Soil | TERLVAILVAITGEYFLFAALAPGALAGRARFALRIAGLRLRREFQ* |
Ga0150985_1009888762 | 3300012212 | Avena Fatua Rhizosphere | MVALLVSITPEYFLFAALAPGALVGRARHALRAAGFALEREFA* |
Ga0137372_102952851 | 3300012350 | Vadose Zone Soil | TELWVVTERLVAILVAITGEYFLFAALAPGALAGRARFALRMAGLRLRGEFQ* |
Ga0137384_101159213 | 3300012357 | Vadose Zone Soil | LTELWVVTERLVAILVAITGEYFLFAALAPGALAGRARFALRMAGLRLRGEFQ* |
Ga0137390_109946401 | 3300012363 | Vadose Zone Soil | KELSIVTERMVALLVAITPEYFLFAALAPGALMGRARFALHAAGMALEREFA* |
Ga0137398_111362591 | 3300012683 | Vadose Zone Soil | TDEYFLFAALAPGALAGRARFALRLAGMSLRREFQ* |
Ga0157284_100774953 | 3300012893 | Soil | GITSEYFLFASLAPGALMGRARFALRLATLALEKEFE* |
Ga0157295_104122281 | 3300012906 | Soil | MLVAITSEYFLFAALAPGAVTGRARFALRLAGLGLEKEFA* |
Ga0157308_103777551 | 3300012910 | Soil | SITPEYFLFAALAPGALMGRARFALHAAGLALEREFA* |
Ga0157298_104482582 | 3300012913 | Soil | SDYFIFAALSPGAITGRARFAMRLAGLGLEKEFA* |
Ga0137419_106502463 | 3300012925 | Vadose Zone Soil | VSITPEYFLFAALAPGALMGRARFALHSAGLALEREFA* |
Ga0164301_112349821 | 3300012960 | Soil | IVAITSEYFLFASLAPDVLLGRARFALRLATLALEKEFE* |
Ga0163162_131828093 | 3300013306 | Switchgrass Rhizosphere | VSDKMVALLVAITPEYFLFAALSPGGLLGRARFAMRLACLGLE |
Ga0075350_11727952 | 3300014315 | Natural And Restored Wetlands | EDYYLFASPAPGAVVGRARYALRLAGLALRREFD* |
Ga0163163_126410701 | 3300014325 | Switchgrass Rhizosphere | LVSITPEYFLFAALAPGALMGRARFALHSAGLALEREFA* |
Ga0157380_103186871 | 3300014326 | Switchgrass Rhizosphere | LVSITPEYFLFAALAPGAVMGRARFALHSAGLALEREFA* |
Ga0157380_125082961 | 3300014326 | Switchgrass Rhizosphere | ALMVGITPEYFLFAALAPGAVAGRARFALRMASLALEQEFL* |
Ga0157380_132861311 | 3300014326 | Switchgrass Rhizosphere | MTALLVAITPVYFLFAALRPDALAGRARFALRLAGAALQPEFV* |
Ga0180084_10439541 | 3300014874 | Soil | RLTTLLVAITPDYFLFASLAPRALMGRARFALRLAALALEREFE* |
Ga0134083_104389371 | 3300017659 | Grasslands Soil | RELWVVTERLVAILVAITGEYFLFAALAPGALAGRARFALRIAGLRLRREFQ |
Ga0184605_102386473 | 3300018027 | Groundwater Sediment | AITPEYFLFAGLAPGALMGRARFALRVAGIALEREFV |
Ga0187787_104680252 | 3300018029 | Tropical Peatland | VAITPEYFLFAALSPDALMGRARFALRLAGIALRREFE |
Ga0184626_101011563 | 3300018053 | Groundwater Sediment | GQLLELSVVTEKMTALLVAITPEYFLFAGLDPGALMGRARFALRVAGLALEREFT |
Ga0184623_102072221 | 3300018056 | Groundwater Sediment | TALLVAITPEYFLFAGLAPGALMGRARFALRVAGLALEREFT |
Ga0066662_110311851 | 3300018468 | Grasslands Soil | TPARLWAITPEYFLFAGLAPGALMGRARFALRLAGLALEKEFI |
Ga0187894_101699523 | 3300019360 | Microbial Mat On Rocks | VTEKMTALLVGITPEYFLFAGLAPGALLGRARFALRLAGSALEREFD |
Ga0193744_10892912 | 3300019874 | Soil | LSIVTEKMVALLVSITPEYFLFAALAPGALMGRARFALHAAGLALEREFA |
Ga0210379_104722671 | 3300021081 | Groundwater Sediment | AITSEYFLFASLAPGAVMGRARFALHLATLALEKEFE |
Ga0207644_110483022 | 3300025931 | Switchgrass Rhizosphere | MVAITEEYFLFASLAPGALLGRARFALRMAGIALEKEFE |
Ga0207651_116254922 | 3300025960 | Switchgrass Rhizosphere | ALLVSITPEYFLFAALAPGAVMGRARFALHSAGLALEREFA |
Ga0207640_121443641 | 3300025981 | Corn Rhizosphere | LTTLLVAITPEYFLFASLAPGAVMGRARFALRLAGLALEREFE |
Ga0207675_1018956192 | 3300026118 | Switchgrass Rhizosphere | MTAVIVAITSEYFLFASLAPDVLLGRARFALRLATLALEKEFE |
Ga0207698_116651052 | 3300026142 | Corn Rhizosphere | ITPEYFLFAALAPGAVMGRARFALHSAGLALEREFA |
Ga0209131_10790143 | 3300026320 | Grasslands Soil | VAITPEYFLFAALAPGALMGRARFALHAAGLALEREFA |
Ga0256815_10221532 | 3300026463 | Sediment | ITTEQMVALLVAITPEYFLFASLPPGALTGRARFALRLAGLSLRGEFE |
Ga0209161_105548432 | 3300026548 | Soil | KELSIVTEKMVALLVSITPEYFLFAGLAPGALTGRARFALRAAGLSLEREFA |
Ga0209797_102572772 | 3300027831 | Wetland Sediment | LVTDRSTTLLVSITPEYFLFASLSKGAIVGRARHALRLAGLSLLPEFE |
Ga0209293_100954591 | 3300027877 | Wetland | TTERMATLLVAITPEYFLFASLTPGALMGRARFALRLAGLALRREFE |
(restricted) Ga0255055_102731993 | 3300027881 | Seawater | LTMVTERMTTLLVAITPEYFLFAALAPGAIVGRARFALRLAGMRLRGEFE |
Ga0307312_100408781 | 3300028828 | Soil | ITPEYFLFAGLAPGALMGRARFALRVAGIALEREFV |
Ga0307278_100453423 | 3300028878 | Soil | ERMIALLVAITPEYFLFAGLAPGALMGRARFALRVAGIALEREFV |
Ga0311350_101207334 | 3300030002 | Fen | TEGVGAVIRAITPEYFVFVALAPGALVGRARLALRVACLSLASEFA |
Ga0311333_102899471 | 3300030114 | Fen | TERMITLLVAITPEYFLFASLAPGALMGRARFALRVAGLGLVREFE |
Ga0308187_103658811 | 3300031114 | Soil | ELSIVTEKMIALLVAITPEYFLFAGLAPGALMGRARFALRVAGIALEREFV |
Ga0299913_121433681 | 3300031229 | Soil | AITSEYFLFAALAPEAVTGRARFALRLAGHGLEKEFA |
Ga0310888_101829533 | 3300031538 | Soil | ERHTTLLVAITPEYFLFASLAPGAVMGRARFALRLAGLALEREFE |
Ga0310887_101026181 | 3300031547 | Soil | IVTERMVALLVSITPEYFLFAALAPGAVMGRARFALHSAGLALEREFA |
Ga0307468_1001972581 | 3300031740 | Hardwood Forest Soil | LNELTIVTEKMVALLVGITPEYFLFAALQPGALLGRARYALREAGIGLQREFA |
Ga0310904_111475651 | 3300031854 | Soil | LRELAITTERLTTLLVAITPEYFLFASLAPGAVMGRARFALRLAGLALEREFE |
Ga0310892_106118932 | 3300031858 | Soil | VGITPEYFLFAALGPGAVIGRARFALRLAGLSLQPEFV |
Ga0310893_104071362 | 3300031892 | Soil | LTAITPEYFLFAALGPDALAGRARFALRVAGMTLQPEFV |
Ga0335085_112057072 | 3300032770 | Soil | PLHELAIATERMTTLLVAITSDYYLFASLAPGAIIGRARYALRLAGLALRPEFE |
Ga0316622_1010827581 | 3300033416 | Soil | ESITSDYYFFACLAPGAILGRARFALRIAGASLEREFA |
Ga0316613_104402351 | 3300033434 | Soil | AITPDYFLFASLAPGAVVGRARFALRLAGLALRREFE |
Ga0316600_113066551 | 3300033481 | Soil | AVVTENMTALLESITSDYYFFACLAPGAILGRARFALRVAGASLEREFV |
Ga0316627_1017979251 | 3300033482 | Soil | LVAITGDYFLFASLAPGAVIGRARYALRLAGLSLRQEFE |
Ga0316630_103752973 | 3300033487 | Soil | ITTERTTTLLVAITPDYFLFASLAPGAVVGRARFALRLAGLALRREFE |
Ga0316630_110091312 | 3300033487 | Soil | LAITTERMATLLVAITPEYFLFASLSPGAVMGRARFALRLAGLSLRREFE |
Ga0316630_116862292 | 3300033487 | Soil | TTDRLTTLLVGITPEYYLYAALAPGALVGRARFALRLAGLALESEFS |
Ga0314862_0035349_3_122 | 3300033803 | Peatland | LLGITSEYFLFAALAPGGIVGRARFALRLAGLSLQREFQ |
Ga0364925_0101992_871_1002 | 3300034147 | Sediment | MTTLLTAITPEYFLFASLAPGALMGRARFALRLAGLALEREFE |
Ga0364923_0078577_17_163 | 3300034690 | Sediment | VVTERMTALLVGITPEYFLFAGLSPGALLGRARFALRLAGLALEREFD |
⦗Top⦘ |