NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105442

Metagenome / Metatranscriptome Family F105442

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105442
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 38 residues
Representative Sequence MRHFRLWLLVIGLASLVAEAIAAAAVFWHGGAPRRS
Number of Associated Samples 82
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 44.33 %
% of genes near scaffold ends (potentially truncated) 18.00 %
% of genes from short scaffolds (< 2000 bps) 79.00 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(28.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 45.31%    β-sheet: 0.00%    Coil/Unstructured: 54.69%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF05437AzlD 47.00
PF03591AzlC 8.00
PF00293NUDIX 8.00
PF08338DUF1731 4.00
PF01370Epimerase 4.00
PF02445NadA 2.00
PF13460NAD_binding_10 2.00
PF00890FAD_binding_2 2.00
PF02749QRPTase_N 1.00
PF02511Thy1 1.00
PF028725_nucleotid_C 1.00
PF02910Succ_DH_flav_C 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG1296Predicted branched-chain amino acid permease (azaleucine resistance)Amino acid transport and metabolism [E] 8.00
COG1090NAD dependent epimerase/dehydratase family enzymeGeneral function prediction only [R] 4.00
COG0379Quinolinate synthaseCoenzyme transport and metabolism [H] 2.00
COG0157Nicotinate-nucleotide pyrophosphorylaseCoenzyme transport and metabolism [H] 1.00
COG07372',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase familyDefense mechanisms [V] 1.00
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 1.00
COG1488Nicotinic acid phosphoribosyltransferaseCoenzyme transport and metabolism [H] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.00 %
UnclassifiedrootN/A12.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c0802188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1003Open in IMG/M
3300000956|JGI10216J12902_101738276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium684Open in IMG/M
3300000956|JGI10216J12902_108835973All Organisms → cellular organisms → Bacteria1669Open in IMG/M
3300000956|JGI10216J12902_113269126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1045Open in IMG/M
3300003993|Ga0055468_10117154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium766Open in IMG/M
3300004156|Ga0062589_100745054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales878Open in IMG/M
3300005577|Ga0068857_100058493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3423Open in IMG/M
3300005713|Ga0066905_100089599All Organisms → cellular organisms → Bacteria2052Open in IMG/M
3300005713|Ga0066905_101548370All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300005719|Ga0068861_101916514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300005937|Ga0081455_10029094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5040Open in IMG/M
3300005937|Ga0081455_10793240All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300006224|Ga0079037_100374234All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300006844|Ga0075428_100275635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1810Open in IMG/M
3300006845|Ga0075421_101739874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300006846|Ga0075430_100691283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria841Open in IMG/M
3300006852|Ga0075433_10283052All Organisms → cellular organisms → Bacteria1469Open in IMG/M
3300006852|Ga0075433_10328128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1353Open in IMG/M
3300006876|Ga0079217_10481516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria765Open in IMG/M
3300006876|Ga0079217_11515101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300009146|Ga0105091_10535849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium598Open in IMG/M
3300009147|Ga0114129_11458997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales842Open in IMG/M
3300009156|Ga0111538_13975078Not Available511Open in IMG/M
3300009162|Ga0075423_10939079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria918Open in IMG/M
3300009176|Ga0105242_12790411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300009553|Ga0105249_10904778All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300010401|Ga0134121_10332500All Organisms → cellular organisms → Bacteria1354Open in IMG/M
3300012530|Ga0136635_10010873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2741Open in IMG/M
3300012897|Ga0157285_10017282All Organisms → cellular organisms → Bacteria1494Open in IMG/M
3300012905|Ga0157296_10096556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales799Open in IMG/M
3300012951|Ga0164300_10196222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium985Open in IMG/M
3300014265|Ga0075314_1019754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1203Open in IMG/M
3300014267|Ga0075313_1028728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1272Open in IMG/M
3300014321|Ga0075353_1093759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium692Open in IMG/M
3300014745|Ga0157377_10206201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1251Open in IMG/M
3300014969|Ga0157376_10625753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1074Open in IMG/M
3300015200|Ga0173480_10056373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1784Open in IMG/M
3300015371|Ga0132258_10113787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6413Open in IMG/M
3300015371|Ga0132258_10277526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4111Open in IMG/M
3300015371|Ga0132258_11071501All Organisms → cellular organisms → Bacteria2037Open in IMG/M
3300015371|Ga0132258_12000613All Organisms → cellular organisms → Bacteria1458Open in IMG/M
3300015372|Ga0132256_101790226Not Available722Open in IMG/M
3300015372|Ga0132256_102409093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300015373|Ga0132257_100787616All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300015374|Ga0132255_100043890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5770Open in IMG/M
3300017965|Ga0190266_10066355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1350Open in IMG/M
3300018066|Ga0184617_1087847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria852Open in IMG/M
3300018073|Ga0184624_10014374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2836Open in IMG/M
3300018073|Ga0184624_10160030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria993Open in IMG/M
3300018082|Ga0184639_10246095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium945Open in IMG/M
3300018083|Ga0184628_10651828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300018422|Ga0190265_10048681All Organisms → cellular organisms → Bacteria3677Open in IMG/M
3300018432|Ga0190275_10023471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia4831Open in IMG/M
3300018466|Ga0190268_12316204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300018469|Ga0190270_10021860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3971Open in IMG/M
3300018469|Ga0190270_10060185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2700Open in IMG/M
3300018469|Ga0190270_10164865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1822Open in IMG/M
3300018469|Ga0190270_10437740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD00591224Open in IMG/M
3300018469|Ga0190270_10581601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD00591087Open in IMG/M
3300018481|Ga0190271_11172620Not Available891Open in IMG/M
3300019356|Ga0173481_10031310All Organisms → cellular organisms → Bacteria1709Open in IMG/M
3300019356|Ga0173481_10808154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300019361|Ga0173482_10195740All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300019487|Ga0187893_10794898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300019884|Ga0193741_1096027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria759Open in IMG/M
3300021329|Ga0210362_1624568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8549Open in IMG/M
3300022214|Ga0224505_10381098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300022898|Ga0247745_1040984Not Available713Open in IMG/M
3300025313|Ga0209431_11137646All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300025326|Ga0209342_11227877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300025538|Ga0210132_1017828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria978Open in IMG/M
3300025551|Ga0210131_1003591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1855Open in IMG/M
3300025567|Ga0210076_1009889All Organisms → cellular organisms → Bacteria2060Open in IMG/M
3300025901|Ga0207688_11006484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300025907|Ga0207645_10084981All Organisms → cellular organisms → Bacteria2031Open in IMG/M
3300025908|Ga0207643_10009094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5335Open in IMG/M
3300025908|Ga0207643_10740418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300025910|Ga0207684_11397663Not Available573Open in IMG/M
3300025931|Ga0207644_11734222Not Available523Open in IMG/M
3300026062|Ga0208654_1009821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1208Open in IMG/M
3300027831|Ga0209797_10290227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300027843|Ga0209798_10340458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium711Open in IMG/M
3300027880|Ga0209481_10493340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300027886|Ga0209486_10151312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1278Open in IMG/M
3300027897|Ga0209254_10242805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1412Open in IMG/M
3300027907|Ga0207428_10345582All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300028755|Ga0307316_10160239Not Available804Open in IMG/M
3300028802|Ga0307503_10206168All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300028819|Ga0307296_10540238Not Available638Open in IMG/M
3300028828|Ga0307312_10259484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1126Open in IMG/M
3300028876|Ga0307286_10203995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria718Open in IMG/M
3300028878|Ga0307278_10032006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2404Open in IMG/M
3300030336|Ga0247826_10621577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria831Open in IMG/M
3300030336|Ga0247826_11774964Not Available505Open in IMG/M
3300030620|Ga0302046_10429675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1084Open in IMG/M
3300031229|Ga0299913_10629485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1054Open in IMG/M
3300033550|Ga0247829_10659156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria871Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil25.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere6.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.00%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands4.00%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment3.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil3.00%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.00%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere2.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.00%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.00%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.00%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks1.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300014265Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2EnvironmentalOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014321Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300021329Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022309Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025538Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025551Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025567Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026062Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_080218833300000033SoilMRHFRSWLLVIGLASLVAEAIAAAAVFWHGGAPRRS*
JGI10216J12902_10173827613300000956SoilMRHFRQWLLLVALASLVAEAIAAAAVFWHGGTPARRTG*
JGI10216J12902_10883597313300000956SoilWLLVIGLASLVAEAAAAAAVFWHRETPLRRSSSS*
JGI10216J12902_11326912623300000956SoilMRHFRLWLLVIALASLVAEAIAAVAVFWRGTPARRAS*
Ga0055468_1011715423300003993Natural And Restored WetlandsMRHFRLWLLAIGALSVVAEAIAAAAVFWRGGLPAARRFRARS*
Ga0062589_10074505413300004156SoilQVDHCGMRHFRSWLLVIGLASLVAEAIAAAAVFWHGGAPRRS*
Ga0068857_10005849323300005577Corn RhizosphereMRHFRLWLLVIGLVSLVAEAIAAAAVFWHGGAPRRS*
Ga0066905_10008959933300005713Tropical Forest SoilMRHFRQWLLVIALASLVAEAIAAAAVFWHGGGQARRAG*
Ga0066905_10154837023300005713Tropical Forest SoilMRHFRMVLVVIGLASLVAEAIAAAAVFWHGGAPRRG*
Ga0068861_10191651423300005719Switchgrass RhizosphereMRHFRQWLLVIALAGLVAEAIAAAAVFWHGQGSARRAG*
Ga0081455_1002909453300005937Tabebuia Heterophylla RhizosphereMRHFRLWLLVIGLLSLAAEALAAAAVFWRGAAKPTGEH*
Ga0081455_1079324023300005937Tabebuia Heterophylla RhizosphereMRHFRQWLLVIALASLVAEAIAAAAVFWHGGAPSRRVS*
Ga0079037_10037423423300006224Freshwater WetlandsMRHFRLWLLTIGLLSLAAEAAAAAAVFWRGSAQRGPS*
Ga0075428_10027563523300006844Populus RhizosphereMRHFRTWLLVIGLASLVAEAAAAAAVFWRGGAPARRS*
Ga0075421_10173987423300006845Populus RhizosphereMRHLRTWLLVIGLASLVAEAAAAAAVFWHGGAPERRSGS*
Ga0075430_10069128323300006846Populus RhizosphereMRHFRLWLLVIGLASLVAEAIAAAAVFWHGGAPRRS*
Ga0075433_1028305233300006852Populus RhizosphereMRHFRQWLLVIALASLVAEAIAAAAVFWHGQGSARRAG*
Ga0075433_1032812833300006852Populus RhizosphereMRHFRQWLLVIALASLVAEAIAAAAVFWHGGSPARRAG*
Ga0079217_1048151613300006876Agricultural SoilTRPIRWRMRHFRTWLRVIGLASLLAEAAAAAAVFWRAGTPLRRP*
Ga0079217_1151510113300006876Agricultural SoilFRTWLLVIGVVSLVAEVAAAAAVFWHGGTPLRRS*
Ga0105091_1053584913300009146Freshwater SedimentMRHFRNWLLVIGLVSLAAEALAAAAVFWPGGAPLRR
Ga0114129_1145899733300009147Populus RhizosphereRHFRLWLLVIGLVSLVAEAIAAAAVFWHGGAPRRS*
Ga0111538_1397507833300009156Populus RhizosphereMRHFRLWLLAIGLASLVAEGIAAAAVFWHGGAPRRS*
Ga0075423_1093907923300009162Populus RhizosphereMRHFRQWLLVIALASLVAEAIAAAAVFWHGGSPARRVG*
Ga0105242_1279041123300009176Miscanthus RhizosphereMRHFRQWLLVIGLASLVAEAIAAAAVFWHGGHQARRSG*
Ga0105249_1090477823300009553Switchgrass RhizosphereMRHFRSWLLVIGLASLLAEAIAAAAVFWHGGAPRRS*
Ga0134121_1033250033300010401Terrestrial SoilMRHFRSWLLVIGLASLVAEAIEAAAVFWHGGAPRRS*
Ga0136635_1001087333300012530Polar Desert SandMRHFRNWLLVIGLVSLAAEALAAAAVFWHGGTPLRRS*
Ga0157285_1001728223300012897SoilMRHFRFWLLVIGLASLVAEAIAAAAVFWHGGAPRRS*
Ga0157296_1009655633300012905SoilMRHFRLWLLLIGLASLVAEAIAAAAVFWHGGAPRRS*
Ga0164300_1019622223300012951SoilMVDYWPMRHFRQWLLVIALASLVAEAIAAAAVFWHGPGSARRAG*
Ga0075314_101975423300014265Natural And Restored WetlandsMRHFRLWLLAIGALSVVAEAIAAAAVFWRGGLPATRRFRAPS*
Ga0075313_102872823300014267Natural And Restored WetlandsMRHFRTWLLLIGLVSLVAEAAAAAAVFWHGGTPLRRSQS*
Ga0075353_109375923300014321Natural And Restored WetlandsMQHFRLWLLFVGVLSLAAEAVAAAAVFWRGHAGRRSAN*
Ga0157377_1020620113300014745Miscanthus RhizosphereCGMRHFRSWLLVIGLASLVAEAIAAAAVFWHGGAPRRS*
Ga0157376_1062575313300014969Miscanthus RhizosphereMRHFRLWLLAIGLVSLVAEAIAAAAVFWHGGAPRRS*
Ga0173480_1005637343300015200SoilMRHFRLWLLVIGLASLLAEAIAAAAVFWHGGAPRRS*
Ga0132258_1011378753300015371Arabidopsis RhizosphereMRHFRLWLLVIGLVSLVAEAIAAAAVFWHGGSPRRS*
Ga0132258_1027752623300015371Arabidopsis RhizosphereMRHFRQWLLVIALASLVAEAIAAAAVFWHGGRPARRAG*
Ga0132258_1107150143300015371Arabidopsis RhizosphereMRHFRQWLFVIALASLVAEAIAAAAVFWHGGRPARRAG*
Ga0132258_1200061333300015371Arabidopsis RhizosphereMVDYWPMRHFRQWLLVIASAISVAEAIASAAVFWLGQGSARRAG
Ga0132256_10179022613300015372Arabidopsis RhizosphereMVDYWPMRHFRQWLLVIALASLVAEAIAAAAVFWHGQGSARRAG*
Ga0132256_10240909323300015372Arabidopsis RhizosphereMRHIRQWLLVIGLASLVAEAIAAAAVFWHGGYPARRSS*
Ga0132257_10078761623300015373Arabidopsis RhizosphereMVDYWPMRHLRQWLLVIALASLVAEAIAAAAVFWHGQGSARRAG*
Ga0132255_10004389053300015374Arabidopsis RhizosphereMRHFRQWLLVIGLASLVAEAIAAAAVFWHGGHAARRSG*
Ga0190266_1006635523300017965SoilMRHFRNWLLVIGLVSLAAEALAAAAVFWHGGTPLRRS
Ga0184617_108784723300018066Groundwater SedimentMRHFKNWLLVIGLASLVAEAIAAAAVFWRGATQTSRP
Ga0184624_1001437433300018073Groundwater SedimentMRHFRTWLLVIGLASLVAEAIAAAAVFWRGAANAHRS
Ga0184624_1016003023300018073Groundwater SedimentMRHFRQWMLVIGLASLVAEAIAAAAVFWHGGTPVRRS
Ga0184639_1024609523300018082Groundwater SedimentMRHFRLWLLTIGVLSLAAEALAAAAVFWGGTARRAQS
Ga0184628_1065182813300018083Groundwater SedimentMRHFRQWLLVIGLASLVAEAIAAAAVFWHGGTPARRS
Ga0190265_1004868163300018422SoilMRHFRRWLLAIGLLSLVAEAVGAAAVFWRGASRQPGAH
Ga0190275_1002347143300018432SoilMGSRMRHFRTWLLVIGLASLVAEAAAAAAVFWHRETPLRRSS
Ga0190268_1231620423300018466SoilMRHFRNWLLVIGLVSLAAEALAAAAVFWHGGTPLRRP
Ga0190270_1002186033300018469SoilMRQFRTWLILIGLASLVAQAAAAAAVFWHGGTPMRRS
Ga0190270_1006018523300018469SoilMRHFRTWLLLIGLASLVAQAAAAAAVFWHGGAPLRRS
Ga0190270_1016486543300018469SoilMRHFRTWLLVIGLASLVAEAAAAAAVFWHGGSPARRSGS
Ga0190270_1043774033300018469SoilGMRHFRTWLLVIGLASLVAEAAAAAAVFWHGGAPARRSGS
Ga0190270_1058160113300018469SoilCRMRHFRTWLLVIGVVSLVAEAAAAAAVFWHGGTPLRRS
Ga0190271_1117262023300018481SoilMRHFRLWLLVIGVASLAAEAVGAAAVFWRASPRRASGA
Ga0173481_1003131023300019356SoilMRHFRQWMLVIGLASLVAEAIAAAAVFWHGGTPARRS
Ga0173481_1080815423300019356SoilMRHFRLWLLVIGLASLLAEAIAAAAVFWHGGAPRRS
Ga0173482_1019574023300019361SoilMRHFRQWLLVIGLASLVAEAIAAAAVFWHGGHAARRSG
Ga0187893_1079489823300019487Microbial Mat On RocksMRHFKTFLLAIGLVSLAAEAIAAAAVFWHGGSPLRRS
Ga0193741_109602723300019884SoilMRHMRTWLLVIGLASLVVEAAAAAAVFWRGGAPARRS
Ga0210362_162456883300021329EstuarineMRHFRLWLLVIGVMSLTAEAIAAAAVFWRGSSPVRGPDGF
Ga0224500_1003091533300022213SedimentMRHFHLWLLMIGALSLAAEAIAAAAFFWRGDFPSRRFGTPRH
Ga0224505_1038109813300022214SedimentMRHFRLWILAIGLVSLAAEAAAAAAVFWRGPEQRGGS
Ga0224510_1033707033300022309SedimentMRHFHLWLLMIGALSLAAEAIAAAAFFWRGGFPSRRFGTPRH
Ga0247745_104098433300022898SoilMRHFRSWLLVIGLASLVAEAIAAAAVFWHGGAPRRS
Ga0209431_1113764613300025313SoilMRHFRLWLLTIGALSLAAEAIAAAAVFWRGAASIRRPGRLG
Ga0209341_1026504433300025325SoilMRHFRLWLLLIAIVSLAAEAIAAAAVFWRGSLRARRPGRL
Ga0209342_1122787713300025326SoilMRHFRLWLLVIGVVSLVAEAIAAAAVFWRGNPSARRPDGL
Ga0210132_101782823300025538Natural And Restored WetlandsMRHFRLWLVLIGALSLAAEAAAAMAVFWRGSIRRSSP
Ga0210131_100359123300025551Natural And Restored WetlandsMRHFRLWLLLIGALSLAAEAAAAMAVFWRGSIRRSSP
Ga0210076_100988913300025567Natural And Restored WetlandsMRHVRLWLLAIALVSVAAEAAAAAAVFWRGGPPERGV
Ga0207688_1100648423300025901Corn, Switchgrass And Miscanthus RhizosphereMRHFRQWLLVIGLASLVAEAIAAAAVFWHGGYPARRSG
Ga0207645_1008498113300025907Miscanthus RhizosphereMRHFRQWLLVIGLASLVAEAIAAAAVFWHGGAPRRS
Ga0207643_1000909433300025908Miscanthus RhizosphereMRHFRLWLLVIGLVSLVAEAIAAAAVFWHGGAPRRS
Ga0207643_1074041833300025908Miscanthus RhizosphereRMRHFRLWLLVIGLVSLVAEAIAAAAVFWHGGAPRRS
Ga0207684_1139766313300025910Corn, Switchgrass And Miscanthus RhizosphereMRHFRQWLLVIALASLVAEAIAAAAVFWHGGSPARRAG
Ga0207644_1173422223300025931Switchgrass RhizosphereMRHFRQWLLVIALASLVAEAIAAAAVFWHGQGSARRAG
Ga0208654_100982123300026062Natural And Restored WetlandsMRHFRTWLLLIGLVSLVAEAAAAAAVFWHGGTPLRRSQS
Ga0209797_1029022723300027831Wetland SedimentHMRHVRLWLLTIGLLSLAAEAAAAAAVFWRGSAQRGSS
Ga0209798_1034045823300027843Wetland SedimentMRHVRLWLLTIGLLSLAAEAAAAAAVFWRGSAQRGSS
Ga0209481_1049334023300027880Populus RhizosphereMRHFRTWLLVIGLASLVAEAAAAAAVFWRGGAPARRS
Ga0209486_1015131223300027886Agricultural SoilMRHFRTWLLVIGLASLLAEAAAAAAVFWRAGTPLRRP
Ga0209254_1024280533300027897Freshwater Lake SedimentMRHIRLWLLTIGLLSLVAEAAAAAAVFWRGSAQRGPS
Ga0207428_1034558233300027907Populus RhizosphereMRHFRLWLLVIGLASLVAEAIAAAAVFWHGGAPRRS
Ga0307316_1016023933300028755SoilMQHFKNWLLVIGLASLVAEAIAAAAVFWRGATQTSRP
Ga0307503_1020616833300028802SoilGDMRHFRQWMLVIGLASLVAEAIAAAAVFWHGGTPARRS
Ga0307296_1054023813300028819SoilMRHFRTWLLVIGLASLVAEAIAAAAVFWRGATQTSRP
Ga0307312_1025948423300028828SoilMRHFKTWLLVIGLASLAAEAIAAVAVFWRGRTPAHRS
Ga0307286_1020399513300028876SoilDEVRMRHFKNWLLVIGLASLVAEAIAAAAVFWRGATQTSRP
Ga0307278_1003200643300028878SoilMRHFKNWLLVIALASLVAEAIAAAAVFWRGATQTSRP
Ga0247826_1062157723300030336SoilMRHFRLWLLVIGLVSLIAEAIAAAAVFWHGGAPRRS
Ga0247826_1177496423300030336SoilAQVDHWRMRHFRLWLLVIGLASLVAEAIAAAAVFWHGGAPRRS
Ga0302046_1042967533300030620SoilMRHFRLWLLVIGVLSLAAEAVAAAAVFWRGSLPHRRPL
Ga0299913_1062948523300031229SoilMRHFRLWLLAIGALSVVAEAIAAAAVFWRGGLPAARRFRAPS
Ga0247829_1065915623300033550SoilMRHFRTWLLVIGVVSLVAEVAAAAAVFWHGGTPLRRS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.