Basic Information | |
---|---|
Family ID | F105414 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 43 residues |
Representative Sequence | ALGIPRGERVLGLLHFGAPEREPAPRERDPVETYVEFLD |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.00 % |
% of genes from short scaffolds (< 2000 bps) | 95.00 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (14.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.96% β-sheet: 0.00% Coil/Unstructured: 91.04% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF00230 | MIP | 40.00 |
PF04024 | PspC | 26.00 |
PF04545 | Sigma70_r4 | 5.00 |
PF00141 | peroxidase | 4.00 |
PF02566 | OsmC | 3.00 |
PF01548 | DEDD_Tnp_IS110 | 1.00 |
PF00596 | Aldolase_II | 1.00 |
PF09922 | DUF2154 | 1.00 |
PF06089 | Asparaginase_II | 1.00 |
PF10099 | RskA | 1.00 |
PF05977 | MFS_3 | 1.00 |
PF13683 | rve_3 | 1.00 |
PF12840 | HTH_20 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 40.00 |
COG0376 | Catalase (peroxidase I) | Inorganic ion transport and metabolism [P] | 4.00 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 3.00 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 3.00 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 1.00 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.00 |
COG4448 | L-asparaginase II | Amino acid transport and metabolism [E] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.00 % |
Unclassified | root | N/A | 14.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908044|A5_c1_ConsensusfromContig71163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
2170459003|FZ032L002GD8J6 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
3300000955|JGI1027J12803_100833317 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300001418|JGI20188J14859_1015486 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300001535|A3PFW1_10749025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 650 | Open in IMG/M |
3300005093|Ga0062594_101759429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
3300005179|Ga0066684_10521813 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300005337|Ga0070682_100432828 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
3300005339|Ga0070660_100308590 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
3300005435|Ga0070714_101366467 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300005437|Ga0070710_11218010 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300005451|Ga0066681_10286909 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300005454|Ga0066687_10558288 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300005526|Ga0073909_10090890 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
3300005538|Ga0070731_10600093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
3300005557|Ga0066704_10941032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
3300005587|Ga0066654_10302237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
3300005598|Ga0066706_10350306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1170 | Open in IMG/M |
3300005885|Ga0075284_1072180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
3300005891|Ga0075283_1047326 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300006046|Ga0066652_101959497 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300006059|Ga0075017_100608078 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300006237|Ga0097621_100224785 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
3300006755|Ga0079222_11468122 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300006797|Ga0066659_11314246 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300006800|Ga0066660_10097083 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
3300006806|Ga0079220_11280289 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300006954|Ga0079219_11517378 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300006954|Ga0079219_11925740 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300009012|Ga0066710_104884035 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300009088|Ga0099830_10114192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2035 | Open in IMG/M |
3300009137|Ga0066709_102263643 | Not Available | 747 | Open in IMG/M |
3300009137|Ga0066709_102954279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
3300009174|Ga0105241_12588587 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300009176|Ga0105242_10815126 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300009545|Ga0105237_11620531 | Not Available | 654 | Open in IMG/M |
3300010396|Ga0134126_11318573 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
3300010396|Ga0134126_13030861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
3300010398|Ga0126383_13157356 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300010866|Ga0126344_1176134 | Not Available | 635 | Open in IMG/M |
3300010880|Ga0126350_11833112 | Not Available | 708 | Open in IMG/M |
3300012019|Ga0120139_1067226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 870 | Open in IMG/M |
3300012201|Ga0137365_10982805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
3300012212|Ga0150985_105508550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
3300012929|Ga0137404_11564575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
3300012960|Ga0164301_10964439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
3300012971|Ga0126369_11513869 | Not Available | 761 | Open in IMG/M |
3300012977|Ga0134087_10360689 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300012987|Ga0164307_11280257 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300012988|Ga0164306_11302265 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300013104|Ga0157370_11730156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
3300013105|Ga0157369_11382199 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300014157|Ga0134078_10117036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1015 | Open in IMG/M |
3300014166|Ga0134079_10627157 | Not Available | 538 | Open in IMG/M |
3300014823|Ga0120170_1088270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
3300015192|Ga0167646_1017752 | Not Available | 1856 | Open in IMG/M |
3300015262|Ga0182007_10278758 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300015264|Ga0137403_11213869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
3300017937|Ga0187809_10000704 | All Organisms → cellular organisms → Bacteria | 17056 | Open in IMG/M |
3300017937|Ga0187809_10050506 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300017937|Ga0187809_10196426 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300017940|Ga0187853_10006159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8156 | Open in IMG/M |
3300017961|Ga0187778_11142111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
3300017966|Ga0187776_10882207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 648 | Open in IMG/M |
3300018433|Ga0066667_10866859 | Not Available | 774 | Open in IMG/M |
3300019356|Ga0173481_10790704 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300020075|Ga0206349_1082091 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300020081|Ga0206354_11009020 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300021363|Ga0193699_10269690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 709 | Open in IMG/M |
3300024245|Ga0247677_1021934 | Not Available | 912 | Open in IMG/M |
3300025909|Ga0207705_10575757 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300025919|Ga0207657_10750848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 756 | Open in IMG/M |
3300025928|Ga0207700_10697031 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300025929|Ga0207664_10763918 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300025934|Ga0207686_10503178 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300025939|Ga0207665_11477136 | Not Available | 540 | Open in IMG/M |
3300025981|Ga0207640_10732108 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300025990|Ga0208527_1006783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1422 | Open in IMG/M |
3300026078|Ga0207702_10171961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1987 | Open in IMG/M |
3300026295|Ga0209234_1210802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 651 | Open in IMG/M |
3300026300|Ga0209027_1134918 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300026317|Ga0209154_1117177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1127 | Open in IMG/M |
3300026318|Ga0209471_1332909 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300026325|Ga0209152_10436737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
3300026550|Ga0209474_10601134 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300027986|Ga0209168_10372772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 696 | Open in IMG/M |
3300028654|Ga0265322_10027902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1613 | Open in IMG/M |
3300031057|Ga0170834_114137736 | Not Available | 713 | Open in IMG/M |
3300031344|Ga0265316_10063969 | All Organisms → cellular organisms → Bacteria | 2850 | Open in IMG/M |
3300031720|Ga0307469_11253359 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300031748|Ga0318492_10288158 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300031765|Ga0318554_10841638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
3300031938|Ga0308175_101226271 | Not Available | 834 | Open in IMG/M |
3300031996|Ga0308176_10381852 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300032074|Ga0308173_10384068 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300032174|Ga0307470_10717114 | Not Available | 764 | Open in IMG/M |
3300032770|Ga0335085_10765210 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300032770|Ga0335085_12496101 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300032828|Ga0335080_10883008 | Not Available | 918 | Open in IMG/M |
3300033004|Ga0335084_10555746 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.00% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.00% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.00% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.00% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.00% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.00% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.00% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001418 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
3300015192 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface) | Environmental | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025990 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A5_c1_00137010 | 2124908044 | Soil | AGVPAGERVLGLLHLGPPEREPAPRERAPVDAYVDFLP |
E4A_00763980 | 2170459003 | Grass Soil | IPAGERVLGLIHLGPPAREPAPRERRPVEQFVEFRP |
JGI1027J12803_1008333171 | 3300000955 | Soil | KAGRDAVGIPQGERFLGLLHFGTAEREPAPREREPVESYVEFLP* |
JGI20188J14859_10154863 | 3300001418 | Arctic Peat Soil | DALGVARGERVLGLLHLGPPEREPAPRDREPVETYVEFLS* |
A3PFW1_107490252 | 3300001535 | Permafrost | MPHGERVLGLIHLGPPAREPAPRERGPVDQYVEFTL* |
Ga0062594_1017594291 | 3300005093 | Soil | EAVGIAGAERVLGLLHFGPPEREPAPRERKTAASYVEFLP* |
Ga0066684_105218131 | 3300005179 | Soil | VLRTARGREALGIPRGERVLGLLHFGAPEREPAPRERDPVETYVEFLD* |
Ga0070682_1004328282 | 3300005337 | Corn Rhizosphere | LRTRPGREAVGLPAGERFLGLLHFGPAVREPAPREREPVGSYVEFLD* |
Ga0070660_1003085901 | 3300005339 | Corn Rhizosphere | EALGIPRGERILGLLHFGAPAREPAAREREPVDRYVEFLG* |
Ga0070714_1013664671 | 3300005435 | Agricultural Soil | PAVLRSAKGREALGIPHGERVLGLLHFGAPAREPAAREREPLERYVQFLD* |
Ga0070710_112180102 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | REAAGVPVGERFLGLLHFGSPEREPAPRDRAPVESYVEFLP* |
Ga0066681_102869091 | 3300005451 | Soil | PQVLRTKAGRESLGMPRGERFLGLLHFGTAEREPAPREREPVESYVEFLS* |
Ga0066687_105582882 | 3300005454 | Soil | TVLRTRPGREAVGLPAGERFLGLLHFGPAVREPAPREREPAGSYVEFLD* |
Ga0073909_100908904 | 3300005526 | Surface Soil | GRDAVGIPAGERFLGLLHFGTAEREPAARERRPVGAYVAFLD* |
Ga0070731_106000931 | 3300005538 | Surface Soil | QGERVLGLLHFGTAAREPAPREREAVDSYVELLT* |
Ga0066704_109410321 | 3300005557 | Soil | EAVGVPDGERVLGLIHLGPPEREPAPRERGAVADYVEFLT* |
Ga0066654_103022371 | 3300005587 | Soil | MGREAVGIPPGERFLGLLHFGAPEREPAPREREPVESYVDFLP* |
Ga0066706_103503062 | 3300005598 | Soil | RTPQVLRTAQGRAAVGIPPGERFLGLLHFGTPAREPAPRERDPVESYVDFLP* |
Ga0075284_10721801 | 3300005885 | Rice Paddy Soil | SRGREALGIPHGERVLGLLHFGTPEREPAPREREPVGAYVEFLP* |
Ga0075283_10473263 | 3300005891 | Rice Paddy Soil | GIPRGERVLGLLHLGSPEREPAPRERAPVDSYVSFLD* |
Ga0066652_1019594971 | 3300006046 | Soil | RTARGREAIGVPDGERVLALLHFGAPLREPVPRERASVDEYVDFLD* |
Ga0075017_1006080782 | 3300006059 | Watersheds | PGRRAVGIPDGERFLGLLHFGTPAREPAPRERQPVESFVEFLD* |
Ga0097621_1002247851 | 3300006237 | Miscanthus Rhizosphere | WRTPQVLRTPPGRSAVGIPDGERFLGLLHFGTAEREPAARERRPVEAYVAFLD* |
Ga0079222_114681222 | 3300006755 | Agricultural Soil | WRTPHVLRTKKGRESIGLPQGERFLGLLHFGTAEREPAPREREPVESYVEFLA* |
Ga0066659_113142461 | 3300006797 | Soil | RDALGVPSGERVLGLIHFGSPEREPAARERAPVAEYVEFLD* |
Ga0066660_100970831 | 3300006800 | Soil | AGERFLGLLHFGPAVREPAPREREPAGSYVEFLD* |
Ga0079220_112802892 | 3300006806 | Agricultural Soil | DGERFLGLLHFGPPAREPAARERRAASEYVTFLP* |
Ga0079219_115173782 | 3300006954 | Agricultural Soil | RTKKGRESVGLPQGERFLGLLHFGTAEREPTPREREPVESYVEFLS* |
Ga0079219_119257401 | 3300006954 | Agricultural Soil | GREAVGIPSGERFLGLLHFGTAVRDPAPREREPVERYVEFLS* |
Ga0066710_1048840352 | 3300009012 | Grasslands Soil | VLRTRPGRETLGIPLGERFLGLLHFGPAAREPAPRERDPVETYVEFLP |
Ga0099830_101141921 | 3300009088 | Vadose Zone Soil | REAVGLPDGERFLGLIHLGPPEREPAPRERGAVADYVEFLP* |
Ga0066709_1022636431 | 3300009137 | Grasslands Soil | PGREAVGLPAGERFLGLLHFGTALREPSPRERDPVGTYVEFLR* |
Ga0066709_1029542792 | 3300009137 | Grasslands Soil | PAGERVLGLLHFGPPAREPAPRERAPVDAYVDFLP* |
Ga0105241_125885872 | 3300009174 | Corn Rhizosphere | GITRGERVLGLLHFGAPAREPAAREREPVERYVDFLD* |
Ga0105242_108151262 | 3300009176 | Miscanthus Rhizosphere | QVLRTKAGRDAVGIPQGERFLGLLHFGTAEREPAPREREPVESYVEFLP* |
Ga0105237_116205311 | 3300009545 | Corn Rhizosphere | PQVLRTKAGRESLGMPRGERFLGLLHFGTAERQPVPREREPVESYVEFLR* |
Ga0134126_113185731 | 3300010396 | Terrestrial Soil | LAIARGELVLGLLHLGPPEREPAAREREPVEKYVEFLT* |
Ga0134126_130308612 | 3300010396 | Terrestrial Soil | AVLRTARGREAVGIAGGERVLALLHLGPPEREPAPRERKTAESYVEFLP* |
Ga0126383_131573562 | 3300010398 | Tropical Forest Soil | VGIPTGERFVGLLHFGTPAREPTPREREPVQSYVEFLP* |
Ga0126344_11761342 | 3300010866 | Boreal Forest Soil | LRTARGRDALGVARGERVLGLLHLGPPERDPAPREREPVETYVEFLA* |
Ga0126350_118331122 | 3300010880 | Boreal Forest Soil | ALGVARGERVLGLLHFGAPAREPAPREREPVDTYVEFLA* |
Ga0120139_10672261 | 3300012019 | Permafrost | WRTPAFVRTARGREALGIPAGERILGLLHFGPPERPPAPRERNPVDAYVAFLP* |
Ga0137365_109828052 | 3300012201 | Vadose Zone Soil | GPGAREAAGLPAGERMLGLLHFGLPVREPAPRERDPVETYLEFLP* |
Ga0150985_1055085502 | 3300012212 | Avena Fatua Rhizosphere | GIPPGERFLGLLHFGTAAREPAPREREPVETYVEFLP* |
Ga0137404_115645752 | 3300012929 | Vadose Zone Soil | AGVPAGERVLGRLHLGPPEREPAARERAPVDTYVDFLP* |
Ga0164301_109644391 | 3300012960 | Soil | GIGRGERVLGLLHLGPPARAPAPRERDPADAYVEFLP* |
Ga0126369_115138692 | 3300012971 | Tropical Forest Soil | REAVGIPSGERFLGLLHFGSAAREPAPRERDPVESYVEFLA* |
Ga0134087_103606891 | 3300012977 | Grasslands Soil | SCERVLGLIHFGSPEREPPARERAPVAEYVEFLD* |
Ga0164307_112802571 | 3300012987 | Soil | LGLPRGERFLGLLHFGTAERQPVPREREPVESYVEFLS* |
Ga0164306_113022651 | 3300012988 | Soil | IRQGERVLGLLHFGAPTREPAARERSAASQYVEFLP* |
Ga0157370_117301562 | 3300013104 | Corn Rhizosphere | ETVGVPAGERVLGLLHFVAPEREPAPRERKTAESYVEFLP* |
Ga0157369_113821991 | 3300013105 | Corn Rhizosphere | TPQVLRTRRGREAVGLPGGERFLGLLHFGTAVREPAPREREPAEAYVEFLA* |
Ga0134078_101170362 | 3300014157 | Grasslands Soil | TRPGREAVGIPPGERFLGLLHFGTAAREPAPREREPVETYVEFLA* |
Ga0134079_106271571 | 3300014166 | Grasslands Soil | VFARTARGREALGIPAGERILGLLHFGQPERPPAPRERNPVDAYVDFLP* |
Ga0120170_10882701 | 3300014823 | Permafrost | DGERVLALLHFGSPEREPAPRDRAPVESYVEFLP* |
Ga0167646_10177522 | 3300015192 | Glacier Forefield Soil | VLRTPPGRAAAGIPAGERFLGLLYFGTPEREPAPRERQPVESFVEFLS* |
Ga0182007_102787582 | 3300015262 | Rhizosphere | VLRSARGREALGITRGERVLGLLHFGAPAREPAAREREPVEQYVDFLD* |
Ga0137403_112138691 | 3300015264 | Vadose Zone Soil | AGERVLGLLHLGPPEREPAARERAPVDTYVDFLP* |
Ga0187809_100007041 | 3300017937 | Freshwater Sediment | PGILRTAKGREAVAIPRGERVLGLLHFGDAVRDPGPRERDPVETYVSFLD |
Ga0187809_100505064 | 3300017937 | Freshwater Sediment | VLRTARGREALGIPRGERVLGLLHFGRPAREPAPREREPVETYVEFLD |
Ga0187809_101964262 | 3300017937 | Freshwater Sediment | GREAIGMPRGERFLGLLHFGAPERDPSPREREPVERYVEFLP |
Ga0187853_1000615910 | 3300017940 | Peatland | PRGERVLGLIHLGAPAREPSPREREPVDTYVDFLD |
Ga0187778_111421112 | 3300017961 | Tropical Peatland | GVPRGERVLGLIHLGPPVREPPPREREAVDTYVVFLA |
Ga0187776_108822072 | 3300017966 | Tropical Peatland | VPDGERVLGLLHLGAPAREPSPREREPVDAVVAFLP |
Ga0066667_108668591 | 3300018433 | Grasslands Soil | GIPPGERFLGLLHFGTAAREPAPREREPVESYVDFLP |
Ga0173481_107907042 | 3300019356 | Soil | VLRTKAGRDAVGIPQGERFLGLLHFGTAEREPAPREREPVESYVEFLP |
Ga0206349_10820912 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | SILRNARGRNAIGIPDGERVLGLLHFGAPAREPAARERTDVSQYVAVLP |
Ga0206354_110090201 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | TPGILRTRRGREAIGIVGGERVLGLLHFGAPVRQPSHRERSPLSQHLWFLP |
Ga0193699_102696901 | 3300021363 | Soil | LGIQAGERVLGLLHFGPPERPPAPRERNPVDAYVEFLP |
Ga0247677_10219342 | 3300024245 | Soil | TKAGRESLGLPRGERFLGLLHFGTAERQPVPREREPVESYVEFLS |
Ga0207705_105757572 | 3300025909 | Corn Rhizosphere | PSILRNARGRNAIGIPDGERVLGLLHFGAPAREPAARERTDVSQYVAVLP |
Ga0207657_107508481 | 3300025919 | Corn Rhizosphere | AAGVPAGERVLGLIHLGAPAREPAARERGPIADVVSFLP |
Ga0207700_106970312 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | IPDGERFLGLLHFGPPAREPAARERRGASEYVAFLP |
Ga0207664_107639181 | 3300025929 | Agricultural Soil | IGVPAGERLLGLLHFGRPAREPAARERAAASHYVEFLP |
Ga0207686_105031782 | 3300025934 | Miscanthus Rhizosphere | QVLRTKAGRDAVGIPQGERFLGLLHFGTAEREPAPREREPVESYVEFLP |
Ga0207665_114771362 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RTPQVLRTKAGRESLGLPRGDRFLGLLHFGTAERQPVPREREPVESYVEFLS |
Ga0207640_107321082 | 3300025981 | Corn Rhizosphere | GIPAGERFLGLLHFGTAEREPAPREREPVESYVEFLA |
Ga0208527_10067831 | 3300025990 | Rice Paddy Soil | AGVPDGERVLGLLHFGPPERAPAAREREPVDAYVEFLP |
Ga0207702_101719614 | 3300026078 | Corn Rhizosphere | ESLGIPRGERFLGLLHFGTAEREPALREREPVESYVEFLS |
Ga0209234_12108022 | 3300026295 | Grasslands Soil | ARGREALGIPSGERILGLLHFGSPEREPAPRERNPVDAYVSFLP |
Ga0209027_11349182 | 3300026300 | Grasslands Soil | RGREALGIARGERVLGLLHLGPPEREPAAREREPVEAYVEFLS |
Ga0209154_11171771 | 3300026317 | Soil | CVRTARGREALGIPSGERILGLLHFGSPEREPAPRERNPVDTYVSFLP |
Ga0209471_13329091 | 3300026318 | Soil | ALGIPRGERVLGLLHFGAPEREPAPRERDPVETYVEFLD |
Ga0209152_104367371 | 3300026325 | Soil | TARGREALGIPSGERILGLLHFGSPEREPAPRERNPVDTYVSFLP |
Ga0209474_106011341 | 3300026550 | Soil | VRTIRGREALGIPAGERVLALLHFGRPVREPSPRERNPVETYVDFLA |
Ga0209168_103727721 | 3300027986 | Surface Soil | EALGVPHGERVLGLVHLGPPAREPAPRERGPVSGVVEFLP |
Ga0265322_100279023 | 3300028654 | Rhizosphere | VGVPHGERVLGLLHFGAVAREPAPREREPVDAYVVFLP |
Ga0170834_1141377362 | 3300031057 | Forest Soil | GRDALGIERGERVLGLLHLGPPEREPASREREPVDTYVEFLG |
Ga0265316_100639691 | 3300031344 | Rhizosphere | PRGERVLGLVHLGSPEREPAPRERASAQTYVEFLA |
Ga0307469_112533592 | 3300031720 | Hardwood Forest Soil | TPAVFRTARGREAAGVPHGERVLALLHFGTPEREPAPRERAQVDAYVSFLD |
Ga0318492_102881581 | 3300031748 | Soil | LRTKPGREAVGIPLGERFLGLLHFGSAEHEPAPRDREPVERYVEFLD |
Ga0318554_108416382 | 3300031765 | Soil | VPPGERVLGLLHFGPPEREPAPRERQPPEQYVEFLP |
Ga0308175_1012262712 | 3300031938 | Soil | WRTPQVLRSKKGRESLGLPPGERFLGLLHFGTAERDPAPRKREPVERYVEFLS |
Ga0308176_103818521 | 3300031996 | Soil | PQILRTRRGREAVGLPEGERFLGLLHFGTALREPAPREREPAEAYVEFLA |
Ga0308173_103840681 | 3300032074 | Soil | SVGIPRGERFLGLLHFGTAEREPAPREREPVERYVDFLS |
Ga0307470_107171142 | 3300032174 | Hardwood Forest Soil | GREAAGLPVGERFLGLLHFGYADREPAPRERQPVESYVEFLA |
Ga0335085_107652101 | 3300032770 | Soil | TPQVLRTKQGREAVGIASAERFLGLLHFGTAVREPAPREREPVESYVEFLP |
Ga0335085_124961011 | 3300032770 | Soil | LRTKPGREAIGIPRGERFLGLLHFGAPDREPAPRDREPVGGYVEFLP |
Ga0335080_108830082 | 3300032828 | Soil | WRTPQVLRTTPGRTAVGIPAGERFLGLLHFGTAEREPAARERRPVEAYVAFLD |
Ga0335084_105557461 | 3300033004 | Soil | TKVGREAVGIPPGERFLGLLHFGSATREPAPREREPAESYVAFLP |
⦗Top⦘ |