| Basic Information | |
|---|---|
| Family ID | F105408 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 53 residues |
| Representative Sequence | MTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYKGMSARRYRHT |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 76.00 % |
| % of genes near scaffold ends (potentially truncated) | 32.00 % |
| % of genes from short scaffolds (< 2000 bps) | 98.00 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF02467 | Whib | 45.00 |
| PF00570 | HRDC | 26.00 |
| PF13361 | UvrD_C | 23.00 |
| PF03109 | ABC1 | 1.00 |
| PF13286 | HD_assoc | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.00 % |
| Unclassified | root | N/A | 4.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_101284241 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300002568|C688J35102_119799653 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300004006|Ga0055453_10046044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1178 | Open in IMG/M |
| 3300004016|Ga0058689_10016012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1187 | Open in IMG/M |
| 3300004114|Ga0062593_101117025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 820 | Open in IMG/M |
| 3300004463|Ga0063356_101442079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1016 | Open in IMG/M |
| 3300004463|Ga0063356_105708113 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300004480|Ga0062592_101760847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300005327|Ga0070658_10255703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1486 | Open in IMG/M |
| 3300005337|Ga0070682_100184521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica | 1460 | Open in IMG/M |
| 3300005338|Ga0068868_100105380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. HCCB10043 | 2286 | Open in IMG/M |
| 3300005339|Ga0070660_100597541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 922 | Open in IMG/M |
| 3300005347|Ga0070668_100915094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 785 | Open in IMG/M |
| 3300005356|Ga0070674_100364651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1171 | Open in IMG/M |
| 3300005436|Ga0070713_100731500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica | 946 | Open in IMG/M |
| 3300005441|Ga0070700_100423546 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300005457|Ga0070662_100753732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 826 | Open in IMG/M |
| 3300005530|Ga0070679_102109926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300005548|Ga0070665_102641669 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005614|Ga0068856_100644055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1080 | Open in IMG/M |
| 3300005615|Ga0070702_100770558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia asaccharolytica | 741 | Open in IMG/M |
| 3300005617|Ga0068859_100299078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1703 | Open in IMG/M |
| 3300005617|Ga0068859_100927865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 955 | Open in IMG/M |
| 3300005718|Ga0068866_10208045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1173 | Open in IMG/M |
| 3300005843|Ga0068860_100440888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1293 | Open in IMG/M |
| 3300005844|Ga0068862_100174784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1924 | Open in IMG/M |
| 3300005985|Ga0081539_10123708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1281 | Open in IMG/M |
| 3300006028|Ga0070717_10841583 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300006237|Ga0097621_100447224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1164 | Open in IMG/M |
| 3300006804|Ga0079221_10584177 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300006806|Ga0079220_10069783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1727 | Open in IMG/M |
| 3300006806|Ga0079220_11449979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
| 3300009101|Ga0105247_11239529 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300009147|Ga0114129_11525663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 820 | Open in IMG/M |
| 3300009148|Ga0105243_10533469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1118 | Open in IMG/M |
| 3300009174|Ga0105241_11044177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 767 | Open in IMG/M |
| 3300009176|Ga0105242_10279302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1516 | Open in IMG/M |
| 3300009551|Ga0105238_10449455 | Not Available | 1285 | Open in IMG/M |
| 3300010154|Ga0127503_10505862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 813 | Open in IMG/M |
| 3300010371|Ga0134125_10480825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1376 | Open in IMG/M |
| 3300010375|Ga0105239_10134784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2749 | Open in IMG/M |
| 3300010397|Ga0134124_10616874 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300010399|Ga0134127_10281017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1593 | Open in IMG/M |
| 3300010401|Ga0134121_10205917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1704 | Open in IMG/M |
| 3300012212|Ga0150985_122192978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 980 | Open in IMG/M |
| 3300012469|Ga0150984_115861764 | Not Available | 586 | Open in IMG/M |
| 3300012469|Ga0150984_118168881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 977 | Open in IMG/M |
| 3300012473|Ga0157340_1023601 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012487|Ga0157321_1005493 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300012951|Ga0164300_10731236 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012960|Ga0164301_11783930 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012985|Ga0164308_10581081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 950 | Open in IMG/M |
| 3300012986|Ga0164304_10407173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 968 | Open in IMG/M |
| 3300014325|Ga0163163_10382773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1464 | Open in IMG/M |
| 3300014969|Ga0157376_10993909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 861 | Open in IMG/M |
| 3300015372|Ga0132256_100525772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1294 | Open in IMG/M |
| 3300017965|Ga0190266_10185819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 977 | Open in IMG/M |
| 3300018465|Ga0190269_11898335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300018466|Ga0190268_10422728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 868 | Open in IMG/M |
| 3300018469|Ga0190270_10585358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1084 | Open in IMG/M |
| 3300018476|Ga0190274_10275839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1545 | Open in IMG/M |
| 3300019356|Ga0173481_10072332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1251 | Open in IMG/M |
| 3300019767|Ga0190267_10303494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 829 | Open in IMG/M |
| 3300020070|Ga0206356_10872460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 984 | Open in IMG/M |
| 3300020082|Ga0206353_11116428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1195 | Open in IMG/M |
| 3300021384|Ga0213876_10085574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1668 | Open in IMG/M |
| 3300022915|Ga0247790_10051919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 945 | Open in IMG/M |
| 3300025321|Ga0207656_10220227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 922 | Open in IMG/M |
| 3300025899|Ga0207642_10089369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1518 | Open in IMG/M |
| 3300025900|Ga0207710_10111960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1297 | Open in IMG/M |
| 3300025900|Ga0207710_10327485 | Not Available | 777 | Open in IMG/M |
| 3300025905|Ga0207685_10764315 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300025920|Ga0207649_10826147 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300025923|Ga0207681_10261771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1354 | Open in IMG/M |
| 3300025927|Ga0207687_10486252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1028 | Open in IMG/M |
| 3300025934|Ga0207686_11748011 | Not Available | 514 | Open in IMG/M |
| 3300025936|Ga0207670_11196518 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300025945|Ga0207679_10267189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1461 | Open in IMG/M |
| 3300025981|Ga0207640_10548918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 970 | Open in IMG/M |
| 3300026023|Ga0207677_10616106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 954 | Open in IMG/M |
| 3300027750|Ga0209461_10105325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
| 3300027765|Ga0209073_10040721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1488 | Open in IMG/M |
| 3300027809|Ga0209574_10025189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1385 | Open in IMG/M |
| 3300028587|Ga0247828_10064290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1635 | Open in IMG/M |
| 3300028590|Ga0247823_10564034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 858 | Open in IMG/M |
| 3300028707|Ga0307291_1031450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1242 | Open in IMG/M |
| 3300028710|Ga0307322_10060884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 933 | Open in IMG/M |
| 3300028715|Ga0307313_10149152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 722 | Open in IMG/M |
| 3300028809|Ga0247824_10360974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 831 | Open in IMG/M |
| 3300028809|Ga0247824_10537690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 694 | Open in IMG/M |
| 3300028812|Ga0247825_10286951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1148 | Open in IMG/M |
| 3300028812|Ga0247825_10463782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 899 | Open in IMG/M |
| 3300028872|Ga0307314_10129643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 713 | Open in IMG/M |
| 3300030336|Ga0247826_10745090 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300031058|Ga0308189_10434312 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300033550|Ga0247829_10626467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 895 | Open in IMG/M |
| 3300033550|Ga0247829_10876520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 747 | Open in IMG/M |
| 3300034666|Ga0314788_035480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 920 | Open in IMG/M |
| 3300034667|Ga0314792_235800 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300034672|Ga0314797_025781 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.00% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 2.00% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.00% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1012842411 | 3300000956 | Soil | ISGGGAPMTNTTMRVITGTHVSGALPVLAQAPRAQKPRVAPFASWIDNYREMSARRYRHT |
| C688J35102_1197996532 | 3300002568 | Soil | MTNTTMRAIPGTHVSGALPVVAPAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0055453_100460443 | 3300004006 | Natural And Restored Wetlands | MTTTTMRAFTGTHIAGAFLVDPTAPRAQKPRVAPFAPWSIDNSREVSAQRYRHT* |
| Ga0058689_100160122 | 3300004016 | Agave | MTITTTRAFMGTHVSGALPVAPTAPRAQKPRVAPFAPWIDNYREMSARRYRHT* |
| Ga0062593_1011170251 | 3300004114 | Soil | MTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT* |
| Ga0063356_1014420792 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT* |
| Ga0063356_1057081131 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTNTTMRAITGTHVSGALPVLAQAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0062592_1017608471 | 3300004480 | Soil | MTNTTMRVITGTHVSGALPVLAQAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0070658_102557032 | 3300005327 | Corn Rhizosphere | VANTTMRAITGTHVSGVLPVATQAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0070682_1001845212 | 3300005337 | Corn Rhizosphere | MTTTTMRAYTGTRVSGALPVAWPTPLAQKPRVAPFAHQIVDNSKGTSARRYCHT* |
| Ga0068868_1001053801 | 3300005338 | Miscanthus Rhizosphere | MTNTTMRAFTGTHVSGALRVVTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT* |
| Ga0070660_1005975412 | 3300005339 | Corn Rhizosphere | VANTTMRAITGTHVSGVLPVAAQAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0070668_1009150942 | 3300005347 | Switchgrass Rhizosphere | MTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNCKGMSARR |
| Ga0070674_1003646511 | 3300005356 | Miscanthus Rhizosphere | MRAFTGTHVSGAPLVLTTAPSAQKPRVAPIAPWIDNCKGMSARRYRHT* |
| Ga0070713_1007315002 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MITTTTMRAITGTRVSGALLPAWTDPRAQKQRVAPFAHWTTDNSRGLSARGYRHT* |
| Ga0070700_1004235461 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0070662_1007537322 | 3300005457 | Corn Rhizosphere | MTTTTMRPYTGTRVSGALPVAWPTPLAQKPRVAPFAHQIVDNSKGTSARRYCHT* |
| Ga0070679_1021099262 | 3300005530 | Corn Rhizosphere | MTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNYTGMSA |
| Ga0070665_1026416691 | 3300005548 | Switchgrass Rhizosphere | PMTITTMRAITGTHVSGALLVDPTAPRAQKPRVAPSAPWFVDNSKEVSARRYRHT* |
| Ga0068856_1006440552 | 3300005614 | Corn Rhizosphere | MTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYKGMSARRYRHT* |
| Ga0070702_1007705582 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MTITTMRAITGTHVSGALLVDPTAPRAQKPRVAPSAPWFVDNSKEVSARRYRHT* |
| Ga0068859_1002990784 | 3300005617 | Switchgrass Rhizosphere | MTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT* |
| Ga0068859_1009278653 | 3300005617 | Switchgrass Rhizosphere | SGGGAPMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0068866_102080453 | 3300005718 | Miscanthus Rhizosphere | HIISGGGAPMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0068860_1004408884 | 3300005843 | Switchgrass Rhizosphere | TGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYKGMSARRYRHT* |
| Ga0068862_1001747841 | 3300005844 | Switchgrass Rhizosphere | HVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0081539_101237082 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MTITTMREFTGTHVAGALVVVPTAPRAQKPRVAPFAPWPIDNSREMSARRYRHT* |
| Ga0070717_108415832 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTITTMRAITGTHASGALLVVPTAPRAQKQRVAPFAPWSTDNSREMSAPRYRHT* |
| Ga0097621_1004472242 | 3300006237 | Miscanthus Rhizosphere | MTNTTMRAITGTHVSGVLPVAAQAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0079221_105841772 | 3300006804 | Agricultural Soil | MTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRCRHT* |
| Ga0079220_100697832 | 3300006806 | Agricultural Soil | MTITTMRAITGTHVSGALFVVPTAPRAQKPRVSPFAPWSADNSREMSARRYRHT* |
| Ga0079220_114499791 | 3300006806 | Agricultural Soil | MTITTMRAITGTHVSGALPVVPTAPFAQKPRVAPFAPWSVDNCREKSALRYRHT* |
| Ga0105247_112395292 | 3300009101 | Switchgrass Rhizosphere | MITTTTMRAITGTRVSGALPVAWPTPLAQKPRVAPFAHQIVDNSKGTSARRYCHT* |
| Ga0114129_115256632 | 3300009147 | Populus Rhizosphere | MTNTTMRAFTGTHVSGALLVDPTAPRAQKPRVAPFASWPVDNYREKSARRYRHT* |
| Ga0105243_105334691 | 3300009148 | Miscanthus Rhizosphere | GALLVVTTAPSAQKPRVAPFAPWIDNYTGMSAQRYRHT* |
| Ga0105241_110441771 | 3300009174 | Corn Rhizosphere | MTTTTMRPYTGTRVSGALPVAWPTPLAQKPRVAPFAHQIGDNSKGTSARRYCHT* |
| Ga0105242_102793022 | 3300009176 | Miscanthus Rhizosphere | MTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNCKGMS |
| Ga0105238_104494551 | 3300009551 | Corn Rhizosphere | MTKTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFASWIDNYREMSARRYRHT |
| Ga0127503_105058623 | 3300010154 | Soil | MTITTMRAITGTHVAGALLVDQTAPRARKPRVAPFAPWSVDNSKEVSARRYRHT* |
| Ga0134125_104808252 | 3300010371 | Terrestrial Soil | MTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT* |
| Ga0105239_101347844 | 3300010375 | Corn Rhizosphere | MTKTTMRAFTGTHVSGAPLVVTMAPSAQKPRVAPFAPWIDNCKGMSARRYRHT* |
| Ga0134124_106168741 | 3300010397 | Terrestrial Soil | ITGTHVSGALPVVAQAPRAQKPRVAPFAPWIDNYREMSARRYRHT* |
| Ga0134127_102810172 | 3300010399 | Terrestrial Soil | MTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPIAPWIDNCKGMSARRYRHT* |
| Ga0134121_102059172 | 3300010401 | Terrestrial Soil | MTNTTMRAITGTHVSGALPVAAQAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0150985_1221929781 | 3300012212 | Avena Fatua Rhizosphere | GTHVSGALPVVAPAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0150984_1158617642 | 3300012469 | Avena Fatua Rhizosphere | MTITTMRATTGTHVSGALLVALTASRAQKPRVAPFAPWIDNYKGMSARRYRHT* |
| Ga0150984_1181688813 | 3300012469 | Avena Fatua Rhizosphere | MAITTMRAITGTHVSGALLVDPTAPRAQKPRVAPFARWSTDNSKEVSARRYRHT* |
| Ga0157340_10236012 | 3300012473 | Arabidopsis Rhizosphere | HIISGGGAPMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFAPWPVDNYREKSARRYRHT* |
| Ga0157321_10054931 | 3300012487 | Arabidopsis Rhizosphere | MTSNTTMRAITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0164300_107312361 | 3300012951 | Soil | GGAPMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0164301_117839302 | 3300012960 | Soil | MTITTMRAITGTHVSGALLVDPTAPRAQKPRVAPFAPWIDNYTGMSARRYRHT* |
| Ga0164308_105810812 | 3300012985 | Soil | MTITTMRAITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT* |
| Ga0164304_104071732 | 3300012986 | Soil | MITNTTMRAITGTHVSGALLVDPTAPRAQKPRVAPFAHWTTDNSRGLSARGYRHT* |
| Ga0163163_103827732 | 3300014325 | Switchgrass Rhizosphere | MTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWSVDNCREKSALRYRHT* |
| Ga0157376_109939091 | 3300014969 | Miscanthus Rhizosphere | MTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNYKGMSARRYRHT* |
| Ga0132256_1005257722 | 3300015372 | Arabidopsis Rhizosphere | MTSNTTMRAITGTRVSGAPLGVWTDPRAQKLRVPPFAHMTTDNSKRTSARRYRQT* |
| Ga0190266_101858191 | 3300017965 | Soil | MTITTMRAITGTHVSGALLVDPTAPRAQKPRVAPFAPWSIDNSREMSARRYRH |
| Ga0190269_118983352 | 3300018465 | Soil | MTITTMRACTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYRGMSARRYRHT |
| Ga0190268_104227282 | 3300018466 | Soil | MTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPFVPWIDNYRGMSARRYRHT |
| Ga0190270_105853582 | 3300018469 | Soil | MTITTMRAITGTHVSGALLVDPTAPRAQKPRVAPFAPWSIDNSREMSARRYRHT |
| Ga0190274_102758392 | 3300018476 | Soil | MTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPIAPWIDNCKGMSARRYRHT |
| Ga0173481_100723322 | 3300019356 | Soil | MTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT |
| Ga0190267_103034941 | 3300019767 | Soil | MTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPIAPWIDNCKGMSARRYRHT |
| Ga0206356_108724601 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | PMTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT |
| Ga0206353_111164283 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | HVRHIISGGGAPMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT |
| Ga0213876_100855743 | 3300021384 | Plant Roots | MTTTTMRVYTGTRVSGALPVAWPTPRAQKTRVAPFAQQIVDNSKGTSARRYRHT |
| Ga0247790_100519191 | 3300022915 | Soil | MTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNCKGMSARRYR |
| Ga0207656_102202272 | 3300025321 | Corn Rhizosphere | MTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFAPWIDNCKGMSARRYRHT |
| Ga0207642_100893691 | 3300025899 | Miscanthus Rhizosphere | VRHIISGGGAPMTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT |
| Ga0207710_101119602 | 3300025900 | Switchgrass Rhizosphere | MTNTTMRVITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYKEMSARRYRHT |
| Ga0207710_103274851 | 3300025900 | Switchgrass Rhizosphere | PYTGTRVSGALPVAWPTPLAQKPRVAPFAHQIVDNSKGTSARRYCHT |
| Ga0207685_107643152 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTITTMREFTGTHVSGALLVVPTALRAQKPRVAPFAPWSIDNYREMSARRYRHT |
| Ga0207649_108261472 | 3300025920 | Corn Rhizosphere | MTNTTMRAFTGTHVSGALRVVTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT |
| Ga0207681_102617713 | 3300025923 | Switchgrass Rhizosphere | MTKTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT |
| Ga0207687_104862522 | 3300025927 | Miscanthus Rhizosphere | MTTTTMRPYTGTRVSGALPVAWPTPLAQKPRVAPFAHQIVDNSKGTSARRYCHT |
| Ga0207686_117480111 | 3300025934 | Miscanthus Rhizosphere | MTNTTMRAITGTHVSGVLPVAAQAPRAQKPRVAPFASWIDNYREMSARRYRHT |
| Ga0207670_111965182 | 3300025936 | Switchgrass Rhizosphere | LPVAAQAPRAQKPRVAPFASWIDNYREMSARRYRHT |
| Ga0207679_102671891 | 3300025945 | Corn Rhizosphere | MTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT |
| Ga0207640_105489182 | 3300025981 | Corn Rhizosphere | MTNTTMRAITGTHVSGALPVVAQAPRAQKPRVAPFASWIDNYREMSARRYRHT |
| Ga0207677_106161062 | 3300026023 | Miscanthus Rhizosphere | MTNTTMRAFTGTHVSGALRVVTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT |
| Ga0209461_101053252 | 3300027750 | Agave | MTITTMRACTGTHVSGALLVVTTAPRAQKPRVAPFAPWIDNYREMSARRYRHT |
| Ga0209073_100407212 | 3300027765 | Agricultural Soil | MTITTMRAITGTHVSGALFVVPTAPRAQKPRVSPFAPWSADNSREMSARRYRHT |
| Ga0209574_100251892 | 3300027809 | Agave | MTITTMRACTGTHVSGALLVVTTAPRAQKPRVAPFAPWIDNYRGMSARRYRHT |
| Ga0247828_100642902 | 3300028587 | Soil | MTNTTMRAITGTHVSGALPVLAQAPRAQKPRVAPFASWIDNYREMSARRYRHT |
| Ga0247823_105640342 | 3300028590 | Soil | MTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYKGMSARRYRHT |
| Ga0307291_10314502 | 3300028707 | Soil | MTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPFAPWIDNCKGMSARRYRHT |
| Ga0307322_100608842 | 3300028710 | Soil | MTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPIAPWIDNCKGMSA |
| Ga0307313_101491522 | 3300028715 | Soil | MTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPFAPWIDNCKGMSARRY |
| Ga0247824_103609742 | 3300028809 | Soil | MTNTTMRAFTGTHVSGAPLVVTTAPSAQKPRVAPSAPWIDNCKGMSARRYRHT |
| Ga0247824_105376902 | 3300028809 | Soil | MTNTTMRAFTGTHVSGALRVVTTAPSAQKPRVAPFAPWIDNYTGMSAQRYRHT |
| Ga0247825_102869512 | 3300028812 | Soil | MTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT |
| Ga0247825_104637822 | 3300028812 | Soil | MTNTTMRAITGTHVSGALLVDPTAPRAQKPRVAPFAPWSIDNSKEMSARRYRHT |
| Ga0307314_101296431 | 3300028872 | Soil | MTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPFAPWIDNCKGMSARRYRH |
| Ga0247826_107450902 | 3300030336 | Soil | VTITTMREITGTHVSGALLVVPTAPRAQKPRVAPFAPWSTDNYREMSARRYRHT |
| Ga0308189_104343122 | 3300031058 | Soil | HNVWRGGAPMTNTTMRAFTGTHVSGAPLVLTTAPSAQKPRVAPIAPWIDNCKGMSARRYRHT |
| Ga0247829_106264671 | 3300033550 | Soil | FTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYKGMSARRYRHT |
| Ga0247829_108765202 | 3300033550 | Soil | MTNTTMRAITGTHVSGALLVDPTAPRAQKPRVAPSAPWFVDNSKEVSARRYRHT |
| Ga0314788_035480_1_198 | 3300034666 | Soil | HVRHNVWRGGAPMTNTTMRAFTGTHVSGALLVVTTAPSAQKPRVAPFAPWIDNYTGMSARRYRHT |
| Ga0314792_235800_3_191 | 3300034667 | Soil | HIAPRRCPVTITMMREFTGTHVSGALLVVPTSPRAQKPRVAPFAPWPVDNYREKSARRYRHT |
| Ga0314797_025781_765_956 | 3300034672 | Soil | RHIISGGGAPMTNTTMRAITGTHVSGALPVLAQAPRAQKPRVAPFASWIDNYREMSARRYRHT |
| ⦗Top⦘ |