| Basic Information | |
|---|---|
| Family ID | F105332 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MPKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEK |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 67.00 % |
| % of genes near scaffold ends (potentially truncated) | 24.00 % |
| % of genes from short scaffolds (< 2000 bps) | 76.00 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (44.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (24.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (76.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.89% β-sheet: 2.63% Coil/Unstructured: 39.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF14311 | DUF4379 | 9.00 |
| PF04098 | Rad52_Rad22 | 7.00 |
| PF13384 | HTH_23 | 2.00 |
| PF00856 | SET | 2.00 |
| PF00145 | DNA_methylase | 1.00 |
| PF16945 | Phage_r1t_holin | 1.00 |
| PF00565 | SNase | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.00 % |
| Unclassified | root | N/A | 44.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10131624 | Not Available | 959 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10184727 | Not Available | 718 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10102061 | All Organisms → Viruses → Predicted Viral | 1078 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10128955 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 899 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10165944 | Not Available | 740 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10182540 | Not Available | 661 | Open in IMG/M |
| 3300001460|JGI24003J15210_10009220 | All Organisms → Viruses → Predicted Viral | 4049 | Open in IMG/M |
| 3300006027|Ga0075462_10003364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5196 | Open in IMG/M |
| 3300006329|Ga0068486_1094194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 676 | Open in IMG/M |
| 3300006484|Ga0070744_10026637 | All Organisms → Viruses → Predicted Viral | 1712 | Open in IMG/M |
| 3300006484|Ga0070744_10047737 | All Organisms → Viruses → Predicted Viral | 1257 | Open in IMG/M |
| 3300006735|Ga0098038_1005367 | All Organisms → cellular organisms → Bacteria | 5219 | Open in IMG/M |
| 3300006752|Ga0098048_1009760 | All Organisms → Viruses → Predicted Viral | 3437 | Open in IMG/M |
| 3300006752|Ga0098048_1100593 | Not Available | 875 | Open in IMG/M |
| 3300006752|Ga0098048_1127198 | Not Available | 764 | Open in IMG/M |
| 3300006789|Ga0098054_1112786 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
| 3300006789|Ga0098054_1303121 | Not Available | 571 | Open in IMG/M |
| 3300006793|Ga0098055_1069715 | All Organisms → Viruses → Predicted Viral | 1392 | Open in IMG/M |
| 3300006793|Ga0098055_1246227 | Not Available | 673 | Open in IMG/M |
| 3300006802|Ga0070749_10394460 | Not Available | 764 | Open in IMG/M |
| 3300006802|Ga0070749_10598891 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 594 | Open in IMG/M |
| 3300006810|Ga0070754_10084436 | All Organisms → Viruses → Predicted Viral | 1595 | Open in IMG/M |
| 3300006867|Ga0075476_10028867 | All Organisms → Viruses → Predicted Viral | 2341 | Open in IMG/M |
| 3300006869|Ga0075477_10417542 | Not Available | 520 | Open in IMG/M |
| 3300006916|Ga0070750_10470370 | Not Available | 518 | Open in IMG/M |
| 3300006920|Ga0070748_1026194 | All Organisms → Viruses → Predicted Viral | 2415 | Open in IMG/M |
| 3300006921|Ga0098060_1088809 | Not Available | 882 | Open in IMG/M |
| 3300006924|Ga0098051_1126394 | Not Available | 680 | Open in IMG/M |
| 3300006925|Ga0098050_1108078 | Not Available | 709 | Open in IMG/M |
| 3300007540|Ga0099847_1033423 | All Organisms → Viruses → Predicted Viral | 1647 | Open in IMG/M |
| 3300007900|Ga0111031_1044278 | All Organisms → Viruses → Predicted Viral | 2757 | Open in IMG/M |
| 3300008999|Ga0102816_1203531 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 619 | Open in IMG/M |
| 3300009000|Ga0102960_1014717 | All Organisms → Viruses → Predicted Viral | 2948 | Open in IMG/M |
| 3300009001|Ga0102963_1125752 | All Organisms → Viruses → Predicted Viral | 1039 | Open in IMG/M |
| 3300009027|Ga0102957_1043100 | All Organisms → Viruses → Predicted Viral | 1547 | Open in IMG/M |
| 3300009086|Ga0102812_10393194 | Not Available | 755 | Open in IMG/M |
| 3300009124|Ga0118687_10145361 | Not Available | 845 | Open in IMG/M |
| 3300009425|Ga0114997_10412199 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 729 | Open in IMG/M |
| 3300009433|Ga0115545_1331094 | Not Available | 504 | Open in IMG/M |
| 3300009443|Ga0115557_1243148 | Not Available | 691 | Open in IMG/M |
| 3300010150|Ga0098056_1188289 | Not Available | 691 | Open in IMG/M |
| 3300010150|Ga0098056_1203009 | Not Available | 662 | Open in IMG/M |
| 3300017697|Ga0180120_10175297 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 898 | Open in IMG/M |
| 3300017713|Ga0181391_1000192 | All Organisms → cellular organisms → Bacteria | 18297 | Open in IMG/M |
| 3300017727|Ga0181401_1017174 | All Organisms → Viruses → Predicted Viral | 2204 | Open in IMG/M |
| 3300017727|Ga0181401_1150100 | Not Available | 568 | Open in IMG/M |
| 3300017748|Ga0181393_1190644 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 500 | Open in IMG/M |
| 3300017751|Ga0187219_1174172 | Not Available | 607 | Open in IMG/M |
| 3300017752|Ga0181400_1164618 | Not Available | 624 | Open in IMG/M |
| 3300017752|Ga0181400_1200975 | Not Available | 550 | Open in IMG/M |
| 3300017755|Ga0181411_1007787 | All Organisms → Viruses → Predicted Viral | 3620 | Open in IMG/M |
| 3300017755|Ga0181411_1046436 | Not Available | 1345 | Open in IMG/M |
| 3300017758|Ga0181409_1089066 | Not Available | 926 | Open in IMG/M |
| 3300017783|Ga0181379_1004765 | All Organisms → cellular organisms → Bacteria | 5940 | Open in IMG/M |
| 3300017783|Ga0181379_1298948 | Not Available | 547 | Open in IMG/M |
| 3300017786|Ga0181424_10164656 | Not Available | 948 | Open in IMG/M |
| 3300017950|Ga0181607_10026703 | All Organisms → Viruses → Predicted Viral | 4241 | Open in IMG/M |
| 3300017963|Ga0180437_10009658 | Not Available | 11895 | Open in IMG/M |
| 3300020053|Ga0181595_10353807 | Not Available | 583 | Open in IMG/M |
| 3300020188|Ga0181605_10348419 | Not Available | 604 | Open in IMG/M |
| 3300020269|Ga0211484_1002130 | All Organisms → cellular organisms → Bacteria | 5246 | Open in IMG/M |
| 3300020413|Ga0211516_10040372 | All Organisms → Viruses → Predicted Viral | 2407 | Open in IMG/M |
| 3300020810|Ga0181598_1013790 | Not Available | 5241 | Open in IMG/M |
| 3300021185|Ga0206682_10347269 | Not Available | 637 | Open in IMG/M |
| 3300021375|Ga0213869_10007592 | All Organisms → cellular organisms → Bacteria | 6715 | Open in IMG/M |
| 3300021375|Ga0213869_10200138 | Not Available | 901 | Open in IMG/M |
| 3300021958|Ga0222718_10032936 | All Organisms → Viruses → Predicted Viral | 3446 | Open in IMG/M |
| 3300021958|Ga0222718_10087314 | All Organisms → Viruses → Predicted Viral | 1865 | Open in IMG/M |
| 3300022057|Ga0212025_1007868 | All Organisms → Viruses → Predicted Viral | 1511 | Open in IMG/M |
| 3300022067|Ga0196895_1000774 | All Organisms → Viruses → Predicted Viral | 3301 | Open in IMG/M |
| 3300022069|Ga0212026_1037673 | Not Available | 719 | Open in IMG/M |
| 3300022071|Ga0212028_1036430 | Not Available | 906 | Open in IMG/M |
| 3300022167|Ga0212020_1040509 | Not Available | 789 | Open in IMG/M |
| 3300022167|Ga0212020_1070681 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 588 | Open in IMG/M |
| 3300022200|Ga0196901_1188843 | Not Available | 667 | Open in IMG/M |
| 3300022306|Ga0224509_10165193 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 786 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10091629 | All Organisms → Viruses → Predicted Viral | 1270 | Open in IMG/M |
| 3300024346|Ga0244775_10171603 | All Organisms → Viruses → Predicted Viral | 1826 | Open in IMG/M |
| 3300024346|Ga0244775_10339658 | All Organisms → Viruses → Predicted Viral | 1241 | Open in IMG/M |
| 3300025070|Ga0208667_1009199 | All Organisms → Viruses → Predicted Viral | 2346 | Open in IMG/M |
| 3300025070|Ga0208667_1011645 | All Organisms → Viruses → Predicted Viral | 1972 | Open in IMG/M |
| 3300025070|Ga0208667_1039350 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium | 805 | Open in IMG/M |
| 3300025084|Ga0208298_1011632 | All Organisms → Viruses → Predicted Viral | 2133 | Open in IMG/M |
| 3300025103|Ga0208013_1055938 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300025103|Ga0208013_1083316 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 824 | Open in IMG/M |
| 3300025108|Ga0208793_1168275 | Not Available | 568 | Open in IMG/M |
| 3300025120|Ga0209535_1006246 | All Organisms → cellular organisms → Bacteria | 7188 | Open in IMG/M |
| 3300025120|Ga0209535_1045621 | All Organisms → Viruses → Predicted Viral | 1914 | Open in IMG/M |
| 3300025543|Ga0208303_1042162 | All Organisms → Viruses → Predicted Viral | 1151 | Open in IMG/M |
| 3300025632|Ga0209194_1156051 | Not Available | 534 | Open in IMG/M |
| 3300025645|Ga0208643_1015690 | All Organisms → Viruses → Predicted Viral | 2758 | Open in IMG/M |
| 3300025671|Ga0208898_1150553 | Not Available | 629 | Open in IMG/M |
| 3300025769|Ga0208767_1207279 | Not Available | 652 | Open in IMG/M |
| 3300026138|Ga0209951_1017245 | All Organisms → Viruses → Predicted Viral | 1601 | Open in IMG/M |
| 3300026187|Ga0209929_1090381 | Not Available | 807 | Open in IMG/M |
| 3300031851|Ga0315320_10286213 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
| 3300032277|Ga0316202_10061871 | All Organisms → Viruses → Predicted Viral | 1745 | Open in IMG/M |
| 3300034374|Ga0348335_052864 | All Organisms → Viruses → Predicted Viral | 1551 | Open in IMG/M |
| 3300034418|Ga0348337_083141 | All Organisms → Viruses → Predicted Viral | 1109 | Open in IMG/M |
| 3300034418|Ga0348337_179416 | Not Available | 555 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 24.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 23.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 13.00% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 6.00% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 5.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.00% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.00% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.00% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.00% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.00% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.00% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.00% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 1.00% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006329 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500m | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007900 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf. Combined Assembly of MM1PM1 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020188 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041411US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020269 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556080-ERR599041) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020810 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022069 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101316241 | 3300000101 | Marine | MTKTYWIKFNNKDFKQDKELVYKMLTDLRVKEINKEEK* |
| DelMOSum2010_101847273 | 3300000101 | Marine | MYKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEK* |
| DelMOSpr2010_101020611 | 3300000116 | Marine | MYKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEE |
| DelMOSpr2010_101289553 | 3300000116 | Marine | MAKTYWIKFNNKDFKQXXELVYKMLTDLRLQEINKEEK* |
| DelMOSpr2010_101659442 | 3300000116 | Marine | MPKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEK* |
| DelMOWin2010_101825402 | 3300000117 | Marine | MPKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEEK* |
| JGI24003J15210_1000922011 | 3300001460 | Marine | MAKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEIK* |
| Ga0075462_100033642 | 3300006027 | Aqueous | MPKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEE* |
| Ga0068486_10941944 | 3300006329 | Marine | MKKSYWIRFKNSDFKKDKELVYKMLTDLRIKEMDINA* |
| Ga0070744_100266377 | 3300006484 | Estuarine | MAKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEE* |
| Ga0070744_100477375 | 3300006484 | Estuarine | MSNMPRTYWVKFNNKEFKQDKELVYKMLTDLRLEEINKEIK* |
| Ga0098038_100536712 | 3300006735 | Marine | MAKTYWVKFNNKDFKQDKELVYKMLTDLRLQEINKEEK* |
| Ga0098048_100976010 | 3300006752 | Marine | MYKTYWIKFNNKDFKEDKELVYKMLTDLRLKEINKENK* |
| Ga0098048_11005934 | 3300006752 | Marine | MPKTYWIKFNNKEFKQDKELVYKMLTDVRLQEINKEEQ* |
| Ga0098048_11271985 | 3300006752 | Marine | MPKTYWIKFNKKDFKQDKELVYKMLTDVRLQEINKEEQ*RILK* |
| Ga0098054_11127862 | 3300006789 | Marine | MANTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEK* |
| Ga0098054_13031212 | 3300006789 | Marine | MPKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEQ* |
| Ga0098055_10697156 | 3300006793 | Marine | MPKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEE* |
| Ga0098055_12462271 | 3300006793 | Marine | IMPKTYWIKFNNKEFKQDKELVYKMLTDVRLQEINKEEQ* |
| Ga0070749_103944602 | 3300006802 | Aqueous | MAKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEYQV* |
| Ga0070749_105988913 | 3300006802 | Aqueous | IMPKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEK* |
| Ga0070754_100844363 | 3300006810 | Aqueous | MPKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEEE* |
| Ga0075476_100288676 | 3300006867 | Aqueous | MAKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEE* |
| Ga0075477_104175423 | 3300006869 | Aqueous | GRIMAKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEE* |
| Ga0070750_104703701 | 3300006916 | Aqueous | IMPKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEE* |
| Ga0070748_10261949 | 3300006920 | Aqueous | MYKTYWIKFNNKDFKQDKELVYKMLTDLRVKEINKEEE* |
| Ga0098060_10888092 | 3300006921 | Marine | MANTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEQ*RILK* |
| Ga0098051_11263941 | 3300006924 | Marine | IMPKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEQ* |
| Ga0098050_11080782 | 3300006925 | Marine | MANTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEQ* |
| Ga0099847_10334231 | 3300007540 | Aqueous | NGGRIMAKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEIK* |
| Ga0111031_10442789 | 3300007900 | Marine Sediment | KTYWIKFNNKDFKQDKELVYKMLTDLRVKEINKEEK* |
| Ga0102816_12035311 | 3300008999 | Estuarine | MPRTYWVKFNNKEFKQDKELVYKMLTDLRLEEINKEIK* |
| Ga0102960_10147173 | 3300009000 | Pond Water | MAKTYWVKFNNKEFKQDKELVYKMLTDLRLEEINKEGE* |
| Ga0102963_11257523 | 3300009001 | Pond Water | MAKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEEE* |
| Ga0102957_10431005 | 3300009027 | Pond Water | MAKTYWIKFNNKDFKQDKELVYKMLTDARLQEINKKEK* |
| Ga0102812_103931942 | 3300009086 | Estuarine | MAKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEQ* |
| Ga0118687_101453611 | 3300009124 | Sediment | MTKTYWVKFNNKEFKQDKELVYKMLTDLRLEEINKEE* |
| Ga0114997_104121992 | 3300009425 | Marine | MAKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEK* |
| Ga0115545_13310943 | 3300009433 | Pelagic Marine | MPKTYWIKFNNKDFKQDKELVYKMLTDLRVKEINKEEE* |
| Ga0115557_12431484 | 3300009443 | Pelagic Marine | MPKTYWIKFNNKDFKQDKELVYKMLTDLRVKEINREEE* |
| Ga0098056_11882891 | 3300010150 | Marine | MANTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEE |
| Ga0098056_12030091 | 3300010150 | Marine | RIMPKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEQ* |
| Ga0180120_101752973 | 3300017697 | Freshwater To Marine Saline Gradient | MAKTYWIKFNNKDFKKDKELVYKMLTDLRVKEINKEEK |
| Ga0181391_100019220 | 3300017713 | Seawater | MDKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEIK |
| Ga0181401_10171743 | 3300017727 | Seawater | MPKTYWIKFNNKDFKHDKELVYKMLTDVRLQEINKEEQ |
| Ga0181401_11501001 | 3300017727 | Seawater | MAKTYWIKFNNREFKQDKELVYKMLTDVRLQEINKEE |
| Ga0181393_11906443 | 3300017748 | Seawater | MAKTYWIKFNNKDFKQDKELVYKMLTDSRLEEINKEIK |
| Ga0187219_11741723 | 3300017751 | Seawater | AKTYWIKFNNKNFKQDKELVYKMLTDVRLQEINKEEE |
| Ga0181400_11646182 | 3300017752 | Seawater | MDKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKE |
| Ga0181400_12009751 | 3300017752 | Seawater | TMDKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEK |
| Ga0181411_10077872 | 3300017755 | Seawater | MAKTYWIKFNNKDFKQDKELVYKMLTDARLQEINKEEQ |
| Ga0181411_10464362 | 3300017755 | Seawater | MPKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEE |
| Ga0181409_10890662 | 3300017758 | Seawater | MPKTYWIKFNNKDFKQDKELVYKMLTDVQLQEINKEEQ |
| Ga0181379_100476515 | 3300017783 | Seawater | MTKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEIK |
| Ga0181379_12989482 | 3300017783 | Seawater | MAKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEK |
| Ga0181424_101646563 | 3300017786 | Seawater | MAKTYWIKFNNKDFKKDKELVYKMLTDLRLEEINKEIK |
| Ga0181607_100267033 | 3300017950 | Salt Marsh | MPKTYWIKFNNKDFKQDKELVYKMLTDLRVKEINREEE |
| Ga0180437_1000965818 | 3300017963 | Hypersaline Lake Sediment | MAKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEE |
| Ga0181595_103538073 | 3300020053 | Salt Marsh | GGRIMPKTYWIKFNNKDFKQDKELVYKMLTDLRVKEINREEE |
| Ga0181605_103484191 | 3300020188 | Salt Marsh | XNKAGGRIMPKTYWIKFNNKDFKQDKELVYKMLTDLRVKEINREEE |
| Ga0211484_10021307 | 3300020269 | Marine | MKKSYWIRFKNSDFKKDKELVYKMLTDLRIKEMDINA |
| Ga0211516_100403726 | 3300020413 | Marine | MKRTYWIKFKNSEFKKDNELVYKKLTNLRLQEMKHNA |
| Ga0181598_101379015 | 3300020810 | Salt Marsh | MPKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEE |
| Ga0206682_103472693 | 3300021185 | Seawater | MAKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEIK |
| Ga0213869_100075925 | 3300021375 | Seawater | MAKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEK |
| Ga0213869_102001382 | 3300021375 | Seawater | MYKTYWIKFNNKDFKQDKELVYKMLTDLRVKEINKEEE |
| Ga0222718_100329367 | 3300021958 | Estuarine Water | MAKTYWIKFNNKDFKQDKELVYKMLTDARLQEINKKEK |
| Ga0222718_100873144 | 3300021958 | Estuarine Water | MAKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEGE |
| Ga0212025_10078681 | 3300022057 | Aqueous | XXNKTGGRMMPKTYWIKFNNEDFKQDKELVYKMLTDLRLQEINKEEYQV |
| Ga0196895_10007742 | 3300022067 | Aqueous | MPKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEK |
| Ga0212026_10376731 | 3300022069 | Aqueous | PKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEEE |
| Ga0212028_10364301 | 3300022071 | Aqueous | AGGRIMPKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEEE |
| Ga0212020_10405092 | 3300022167 | Aqueous | MPKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEEE |
| Ga0212020_10706813 | 3300022167 | Aqueous | IMPKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEK |
| Ga0196901_11888431 | 3300022200 | Aqueous | TYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEEE |
| Ga0224509_101651932 | 3300022306 | Sediment | MTKTYWVKFNNREFKQDKELVYKMLTDLRLEEINKEIK |
| (restricted) Ga0233412_100916292 | 3300023210 | Seawater | MAKTYWIKFNNKDFKQDKELVYKMLTDARLQEINKEEE |
| Ga0244775_101716034 | 3300024346 | Estuarine | MAKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEE |
| Ga0244775_103396585 | 3300024346 | Estuarine | MSNMPRTYWVKFNNKEFKQDKELVYKMLTDLRLEEINKEIK |
| Ga0208667_10091996 | 3300025070 | Marine | MPKTYWIKFNNKEFKQDKELVYKMLTDVRLQEINKEEQ |
| Ga0208667_10116453 | 3300025070 | Marine | MAKTYWVKFNNKDFKQDKELVYKMLTDLRLQEINKEEK |
| Ga0208667_10393502 | 3300025070 | Marine | MYKTYWIKFNNKDFKEDKELVYKMLTDLRLKEINKENK |
| Ga0208298_10116329 | 3300025084 | Marine | MPKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEE |
| Ga0208013_10559382 | 3300025103 | Marine | MANTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEK |
| Ga0208013_10833164 | 3300025103 | Marine | MPKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEQ |
| Ga0208793_11682751 | 3300025108 | Marine | GGIMPKTYWIKFNNKDFKQDKELVYKMLTDVRLQEINKEEQ |
| Ga0209535_10062466 | 3300025120 | Marine | MAKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEIK |
| Ga0209535_10456214 | 3300025120 | Marine | MPRTYWVKFNNKEFKQDKELVYKMLTDLRLEEINKEIK |
| Ga0208303_10421623 | 3300025543 | Aqueous | MAKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEYQV |
| Ga0209194_11560513 | 3300025632 | Pelagic Marine | MPKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEKE |
| Ga0208643_10156908 | 3300025645 | Aqueous | MYKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEK |
| Ga0208898_11505533 | 3300025671 | Aqueous | MPKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEEK |
| Ga0208767_12072793 | 3300025769 | Aqueous | YWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEYQV |
| Ga0209951_10172453 | 3300026138 | Pond Water | MAKTYWVKFNNKEFKQDKELVYKMLTDLRLEEINKEGE |
| Ga0209929_10903812 | 3300026187 | Pond Water | MAKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEEE |
| Ga0315320_102862133 | 3300031851 | Seawater | MAKTYWIKFNNKDFKHDKELVYKMLTDLRLEEINKEIK |
| Ga0316202_100618714 | 3300032277 | Microbial Mat | MTKTYWIKFNNKDFKQDKELVYKMLTDLRLEEINKEEE |
| Ga0348335_052864_888_1010 | 3300034374 | Aqueous | MPKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEEYQV |
| Ga0348337_083141_1003_1107 | 3300034418 | Aqueous | MPKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINK |
| Ga0348337_179416_3_137 | 3300034418 | Aqueous | KHNGGRIMAKTYWIKFNNKDFKQDKELVYKMLTDLRLQEINKEE |
| ⦗Top⦘ |