NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105331

Metagenome / Metatranscriptome Family F105331

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105331
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 63 residues
Representative Sequence MEKLKQLGLQMEQQMKDSLGYDEKSGFWYDKEDEESTYTEEGIRLAVYEDIKDTLNYLYSECAY
Number of Associated Samples 82
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 53.00 %
% of genes near scaffold ends (potentially truncated) 25.00 %
% of genes from short scaffolds (< 2000 bps) 72.00 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.77

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (86.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(29.000 % of family members)
Environment Ontology (ENVO) Unclassified
(71.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(91.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.57%    β-sheet: 8.70%    Coil/Unstructured: 46.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.77
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.58.60.1: FepE-liked4e29a_4e290.62853
d.241.2.1: Trigger factor ribosome-binding domaind1p9ya_1p9y0.61498
f.5.1.1: Outer membrane efflux proteins (OEP)d1ek9a_1ek90.61381
d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domaind1e7ua41e7u0.61328
a.213.1.1: YfiT-like putative metal-dependent hydrolasesd1rxqa_1rxq0.61253


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF04545Sigma70_r4 4.00
PF07068Gp23 2.00
PF06067DUF932 2.00
PF04321RmlD_sub_bind 1.00
PF14819QueF_N 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0451Nucleoside-diphosphate-sugar epimeraseCell wall/membrane/envelope biogenesis [M] 2.00
COG0702Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domainsGeneral function prediction only [R] 2.00
COG1086NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsCCell wall/membrane/envelope biogenesis [M] 2.00
COG1087UDP-glucose 4-epimeraseCell wall/membrane/envelope biogenesis [M] 1.00
COG1088dTDP-D-glucose 4,6-dehydrataseCell wall/membrane/envelope biogenesis [M] 1.00
COG1089GDP-D-mannose dehydrataseCell wall/membrane/envelope biogenesis [M] 1.00
COG1090NAD dependent epimerase/dehydratase family enzymeGeneral function prediction only [R] 1.00
COG1091dTDP-4-dehydrorhamnose reductaseCell wall/membrane/envelope biogenesis [M] 1.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A86.00 %
All OrganismsrootAll Organisms14.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003620|JGI26273J51734_10180802Not Available538Open in IMG/M
3300004097|Ga0055584_101298473Not Available758Open in IMG/M
3300005523|Ga0066865_10177079Not Available795Open in IMG/M
3300005608|Ga0066840_10000168Not Available9975Open in IMG/M
3300005837|Ga0078893_10204362All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium4422Open in IMG/M
3300006027|Ga0075462_10021461Not Available2082Open in IMG/M
3300006332|Ga0068500_1007599All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium2475Open in IMG/M
3300006350|Ga0099954_1086062Not Available990Open in IMG/M
3300006617|Ga0101443_136815Not Available3495Open in IMG/M
3300006789|Ga0098054_1197713Not Available733Open in IMG/M
3300006868|Ga0075481_10218354Not Available678Open in IMG/M
3300006870|Ga0075479_10428474Not Available509Open in IMG/M
3300006916|Ga0070750_10105435All Organisms → Viruses → Predicted Viral1303Open in IMG/M
3300007236|Ga0075463_10186332Not Available669Open in IMG/M
3300007552|Ga0102818_1061542Not Available740Open in IMG/M
3300007655|Ga0102825_1025741All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1200Open in IMG/M
3300008964|Ga0102889_1106148Not Available832Open in IMG/M
3300009052|Ga0102886_1114899Not Available812Open in IMG/M
3300009130|Ga0118729_1027423All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium3677Open in IMG/M
3300009130|Ga0118729_1223315Not Available720Open in IMG/M
3300009420|Ga0114994_11117482Not Available508Open in IMG/M
3300009677|Ga0115104_10286433Not Available626Open in IMG/M
3300009677|Ga0115104_10584290Not Available703Open in IMG/M
3300009677|Ga0115104_10902354Not Available2339Open in IMG/M
3300012928|Ga0163110_10101276Not Available1924Open in IMG/M
3300017706|Ga0181377_1008043Not Available2646Open in IMG/M
3300017706|Ga0181377_1022110All Organisms → Viruses → Predicted Viral1383Open in IMG/M
3300017709|Ga0181387_1037300Not Available958Open in IMG/M
3300017709|Ga0181387_1048632Not Available843Open in IMG/M
3300017714|Ga0181412_1000613Not Available14993Open in IMG/M
3300017720|Ga0181383_1142807Not Available643Open in IMG/M
3300017725|Ga0181398_1008660All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium2620Open in IMG/M
3300017727|Ga0181401_1011224Not Available2823Open in IMG/M
3300017727|Ga0181401_1014916All Organisms → Viruses → Predicted Viral2390Open in IMG/M
3300017729|Ga0181396_1075706Not Available678Open in IMG/M
3300017730|Ga0181417_1004047Not Available4042Open in IMG/M
3300017730|Ga0181417_1010351Not Available2406Open in IMG/M
3300017732|Ga0181415_1041118Not Available1058Open in IMG/M
3300017733|Ga0181426_1045556Not Available865Open in IMG/M
3300017743|Ga0181402_1006120All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium3820Open in IMG/M
3300017745|Ga0181427_1002985Not Available4260Open in IMG/M
3300017745|Ga0181427_1107628Not Available680Open in IMG/M
3300017746|Ga0181389_1074531Not Available958Open in IMG/M
3300017750|Ga0181405_1031125Not Available1451Open in IMG/M
3300017760|Ga0181408_1072181Not Available908Open in IMG/M
3300017763|Ga0181410_1067690Not Available1069Open in IMG/M
3300017764|Ga0181385_1018144Not Available2256Open in IMG/M
3300017764|Ga0181385_1119515Not Available804Open in IMG/M
3300017765|Ga0181413_1224261Not Available558Open in IMG/M
3300017768|Ga0187220_1023885Not Available1839Open in IMG/M
3300017768|Ga0187220_1134803Not Available747Open in IMG/M
3300017769|Ga0187221_1118364Not Available800Open in IMG/M
3300017776|Ga0181394_1045809Not Available1485Open in IMG/M
3300017779|Ga0181395_1093071Not Available968Open in IMG/M
3300017779|Ga0181395_1114615Not Available859Open in IMG/M
3300017786|Ga0181424_10096559Not Available1276Open in IMG/M
3300017818|Ga0181565_10220294All Organisms → Viruses → Predicted Viral1298Open in IMG/M
3300018048|Ga0181606_10514705Not Available624Open in IMG/M
3300018420|Ga0181563_10703839Not Available557Open in IMG/M
3300018428|Ga0181568_11023213Not Available628Open in IMG/M
3300020182|Ga0206129_10242763Not Available762Open in IMG/M
3300020408|Ga0211651_10193218Not Available796Open in IMG/M
3300020450|Ga0211641_10102334Not Available1468Open in IMG/M
3300020463|Ga0211676_10199926Not Available1209Open in IMG/M
3300020463|Ga0211676_10317729Not Available881Open in IMG/M
3300020469|Ga0211577_10034029Not Available3839Open in IMG/M
3300020469|Ga0211577_10854053Not Available519Open in IMG/M
3300021957|Ga0222717_10008445All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium7261Open in IMG/M
3300021957|Ga0222717_10083825Not Available2012Open in IMG/M
3300021957|Ga0222717_10133613Not Available1525Open in IMG/M
3300021959|Ga0222716_10008365All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium7903Open in IMG/M
3300022065|Ga0212024_1042880Not Available786Open in IMG/M
3300022068|Ga0212021_1122094Not Available533Open in IMG/M
(restricted) 3300022920|Ga0233426_10395589Not Available513Open in IMG/M
(restricted) 3300023109|Ga0233432_10060696Not Available2317Open in IMG/M
3300024228|Ga0228633_1065094Not Available893Open in IMG/M
3300024235|Ga0228665_1001609Not Available4388Open in IMG/M
3300024266|Ga0228661_1111818Not Available513Open in IMG/M
3300024322|Ga0228656_1051123Not Available921Open in IMG/M
3300024322|Ga0228656_1058173Not Available854Open in IMG/M
3300024322|Ga0228656_1092696Not Available649Open in IMG/M
3300024346|Ga0244775_10724790Not Available800Open in IMG/M
3300024420|Ga0228632_1161470Not Available519Open in IMG/M
3300025137|Ga0209336_10008906Not Available4111Open in IMG/M
3300025168|Ga0209337_1069210All Organisms → Viruses → Predicted Viral1752Open in IMG/M
3300025719|Ga0209252_1162231All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium711Open in IMG/M
3300026189|Ga0208405_1001989Not Available3469Open in IMG/M
3300027183|Ga0208798_1036067Not Available569Open in IMG/M
3300027813|Ga0209090_10581625Not Available509Open in IMG/M
3300028196|Ga0257114_1190424Not Available764Open in IMG/M
3300028197|Ga0257110_1282290Not Available606Open in IMG/M
3300028198|Ga0257121_1002151Not Available14192Open in IMG/M
3300028282|Ga0256413_1024077Not Available1954Open in IMG/M
3300031757|Ga0315328_10019147Not Available3612Open in IMG/M
3300031773|Ga0315332_10847826Not Available552Open in IMG/M
3300031774|Ga0315331_10862611Not Available627Open in IMG/M
3300032011|Ga0315316_10241024Not Available1513Open in IMG/M
3300032047|Ga0315330_10527932Not Available709Open in IMG/M
3300032073|Ga0315315_10006651Not Available10683Open in IMG/M
3300032073|Ga0315315_11887989Not Available505Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater29.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine10.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.00%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater8.00%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.00%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater7.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine5.00%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.00%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water4.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine2.00%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine2.00%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.00%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water2.00%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.00%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.00%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.00%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003620Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005523Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265EnvironmentalOpen in IMG/M
3300005608Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84AEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006332Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200mEnvironmentalOpen in IMG/M
3300006350Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075mEnvironmentalOpen in IMG/M
3300006617Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ09 time pointEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007655Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579EnvironmentalOpen in IMG/M
3300008964Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02EnvironmentalOpen in IMG/M
3300009052Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02EnvironmentalOpen in IMG/M
3300009130Combined Assembly of Gp0139511, Gp0139512EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020408Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118)EnvironmentalOpen in IMG/M
3300020450Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022920 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300024228Seawater microbial communities from Monterey Bay, California, United States - 41DEnvironmentalOpen in IMG/M
3300024235Seawater microbial communities from Monterey Bay, California, United States - 79DEnvironmentalOpen in IMG/M
3300024266Seawater microbial communities from Monterey Bay, California, United States - 75DEnvironmentalOpen in IMG/M
3300024322Seawater microbial communities from Monterey Bay, California, United States - 68DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024420Seawater microbial communities from Monterey Bay, California, United States - 40DEnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025719Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_135m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026189Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A (SPAdes)EnvironmentalOpen in IMG/M
3300027183Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300028198Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031757Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315EnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI26273J51734_1018080223300003620MarineMDKLKELGLQMEQQMKDSLRFDQKTGFWYDKEDEDVFYTEEGIRLAVYEDMKDTINYLYSDCAY*
Ga0055584_10129847313300004097Pelagic MarineMDKLKQLGLQMEQQMKDSLMYNEKSGFWYDKEDEESTYTEEGIRLAVYEDLKDTLNY
Ga0066865_1017707933300005523MarineMEELKRLGLKMEQQMKDSLVYDEKSGFWYDKEDEESTYTEEGIRLAVYEDLKDSLNYLYSECAY*
Ga0066840_10000168123300005608MarineMEELKRLGIKMEQQMKDSLRFDQKTGFWYDKEDQESVYTEEGIRLSVYEDLKDTLNHLYSECAY*
Ga0078893_10204362113300005837Marine Surface WaterMEKIIQLFDEMEKAVKASLTYNPKTGFWYDNDDLDLYYTEEGISLIVYEDLKDSINIIFNNRC*
Ga0075462_1002146143300006027AqueousMEELKKLGQKMEQQMKDSLRFDQKTGFWYDKEDEESIYTEEGIRLAVYEDLKDTLNLLYSECAYK*
Ga0068500_100759923300006332MarineMEDLKKLGLKMEQQMKDSLIYDEKSGFWYDECDGEYYYTEEGIRLAVYEDLKDTLNYLYSDCAY*
Ga0099954_108606233300006350MarineMEELKRLGLKMEKEMKDSLVFNEKTGFWYDKEDEGLVYTEEGIRLRVYEDLKDTLNHLYSECAY*
Ga0101443_13681573300006617Marine Surface WaterMEKEMKDSLVYNEKSGFWYDKEDEESTYTEEGIRLAVYEDLKDTLNYLYSECAY*
Ga0098054_119771313300006789MarineKLKQLGLLMEQQMKATLTLNPKDGFWYDNDDLDVYYTDEGIRLAVYEDLKDTLNHLYSDCAY*
Ga0075481_1021835423300006868AqueousMEELEKLCLKMENQMKERLTHNPEDGFWYDNHDPDACYTHEGIRLAVYEDVKDTLNMLYSECAY*
Ga0075479_1042847413300006870AqueousMEELEKLCLKMENQMKERLTHNPEDGFWYDNHDPDACYTHEGIRLAVYEDVKDTL
Ga0070750_1010543513300006916AqueousLNRLALQMEQQMKDSLGFDEKTGFWYDKEDQDSFYTEEGIRLAVYEDLKDCLNMIYSECAYN*
Ga0075463_1018633213300007236AqueousLQMEQQMKDSLGFDEKTGFWYDKEDQDSFYTEEGIRLAVYEDLKDCLNMIYSECAYN*
Ga0102818_106154223300007552EstuarineMEKLKQLGSQMEQQMKDSLVYDDKSGFWYDKQDEDSFYTEEGIRLAVYEDLKDTLNYLYSDCAC*
Ga0102825_102574133300007655EstuarineMEKLKQLGSQMEQQMKDSLGYDDKSGFWYDKQDEDVFYTEEGIRLAVYEDLKDTLNYLYSDCAC*
Ga0102889_110614823300008964EstuarineMERLKQLGLQMEQQMKDSLRYDDKTGFWYDKEDEDVFYTEEGIRLAVYEDMKDTLNYLYSDCAC*
Ga0102886_111489943300009052EstuarineMERLKQLGLQMEQQMKDSLRYDEKTGFWYDKEDEDVFYTEEGIRLAVYEDMKDTLNYLYSDCAC*
Ga0118729_102742333300009130MarineMDKLKELGKEMEDQMKDTLIYNDKDGFWYEKDDKYTFYTEEGIRLSVYEDLRDTLNYLYSDCCY*
Ga0118729_122331523300009130MarineMEELKKLGLKMEQQIKDSLVFNEKNGFWYDKEDEELVYTEEGIRLTVYEDLKDTLNYLYSECAY*
Ga0114994_1111748223300009420MarineMVNVEQLGLQMEREMKSTLTYNPKDGFWYDNDDLDTYYTDEGIRLAVYEDLKDTLNYLYSDCAY*
Ga0115104_1028643323300009677MarineMEELRKLGQKMEQQMKDSLRFDQKTGFWYDKEDQDSYYTEEGIRLSVYEDLKDTLNYLYSDCAC*
Ga0115104_1058429023300009677MarineMEELKKLGIRMEQQMKDSLVYDEKRGFWYDQADEESTYTEEGIRLSVYEDLKDTLNHLYSECAY*
Ga0115104_1090235423300009677MarineLRVELIKEISYYNIMDKLKQLGLQMEQQMKDSLVYDEKRGFWYDKEDEESTYTEEGIRLAVYEDIKDTLNYLYSECAY*
Ga0163110_1010127643300012928Surface SeawaterMEDLKKLGLKMEQQMKDSLVYDEKRGFWYDKEDEESTYTEEGIRLAVYEDLKDTLNYLYSECAY*
Ga0181377_100804373300017706MarineMDKIKKLGLEMEKQMKATLTYNPKDGFWYDNDDLDVYYTEEGIRLAVYEDIKDTLNHLYSDCAY
Ga0181377_102211053300017706MarineMEDLKKLGLKMEQDMKATLTLNPKDGFWYDNDDLDTCYTDGGIRLAVYEDLKDTLNHLYSDCAY
Ga0181387_103730033300017709SeawaterMEKLKQLGLQMEQQMKDSLGYDEKSGFWYDKEDEESTYTEEGIRLAVYEDIKDTLNYLYSECAY
Ga0181387_104863223300017709SeawaterMEELKKLGQKMEQQMKDSLRFDQKTGFWYDKEDQDSYYTEEGIRLSVYEDLKDTLNYLYSDCAC
Ga0181412_1000613233300017714SeawaterMEELKKLGIRMEQQMKDSLVYDEKTGFWYDKEDEESTYTEEGIRLAVYEDIKDILNYLYSECAY
Ga0181383_114280733300017720SeawaterVMEELRKLGQKMEQQMKDSLRFDQKTGFWYDKEDQESTYTEEGIRLSVYEDLKDTLNYLYSDCAC
Ga0181398_100866013300017725SeawaterMDKLKELGLQMEQQMKDSLGYDEKSGFWYDKEDEDSFYTEEGIRLAVYEDMKDTIN
Ga0181401_101122443300017727SeawaterMEDLKKLGLKMEKEMKDSLGYDEKSGFWYDKEDEESTYTEEGIRLSVYEDLKDTLNYLYSECAY
Ga0181401_101491663300017727SeawaterMDKLKELGLQMEQQMKDSLGYDEKSGFWYDKEDEDSFYTEEGIRLAVYEDMKDTINFIYSDCAY
Ga0181396_107570623300017729SeawaterMERLKQLGLLMEQQMKATLTLNPKDGFWYDNDDLDTYYTDEGIRLAVYEDLKDTLNYLYSDCAY
Ga0181417_1004047123300017730SeawaterMDKLKELGLQMEQQMKDSLGYDEKTGFWYDKEDEESIYTEEGIRLSVYEDIKDSLNYLYSECAY
Ga0181417_101035173300017730SeawaterMEELKKLGIKMEQQMKDSLVFNEKTGFWYDKEDEESTYTEEGIRLSVYEDLKDTLNYLYSDCAY
Ga0181415_104111843300017732SeawaterMEKLKELGLQMEQQMKDSLVYDEKNGFWYDKEDEESTYTEEGIRLAVYEDIKDILNYLYSECAY
Ga0181426_104555613300017733SeawaterMEQQMKDSLRFDQKTGFWYDKEDEESVYTEEGIRLSVYEDLKDTLNYLYSDCAY
Ga0181402_100612093300017743SeawaterMDKLKELGLQMEQQMKDSLGYDEKSGFWYDKEDEESFYTEEGIRLAVYEDMKDTINFIYSDCAY
Ga0181427_100298573300017745SeawaterMEQQMKDSLVYDEKTGFWYDKEDEESTYTEEGIRLAVYEDIKDILNYLYSECAY
Ga0181427_110762823300017745SeawaterMEELKKLGIKMEQQMKDSLRFDQKTGFWYDKEDEESVYTEEGIRLSVYEDLKDTLNYLYSDCAY
Ga0181389_107453123300017746SeawaterLVIDVALSREIDYNYVMDKLKELGLQMEQQMKDSLGYDEKSGFWYDKEDEESFYTEEGIRLAVYEDMKDTINFIYSDCAY
Ga0181405_103112523300017750SeawaterMEELKKLGQKMEQQMKDSLRFDQKTGFWYDKEDQESTYTEEGIRLSVYEDLKDTLNYLYSDCAC
Ga0181408_107218113300017760SeawaterMDKLKELGLQMEQQMKDSLRFDQKTGFWYDKEDEESTYTEEGIRLSVYEDLKDTLNYLYS
Ga0181410_106769013300017763SeawaterELGLQMEQQMKDSLRFDQKTGFWYDKEDEESTYTEEGIRLSVYEDLKDTLNYLYSDCAY
Ga0181385_101814483300017764SeawaterMEELRKLGQKMEQQMKDSLRFDQKTGFWYDKEDEESVYTEEGIRLSVYEDLKDTLNYLYSDCAY
Ga0181385_111951533300017764SeawaterMEELKKLGIKMEQQMKDSLVFNEKTGFWYDKEDEESVYTEEGIRLSVYEDLKDTLNYLYSDCAC
Ga0181413_122426123300017765SeawaterLWKEFEVALIKESADNHIMDKLKQLGLQMEQQMKDSLIYDEKSGFWYDKEDEESTYTEEGIRLAVYEDIKDILNYLYSECAY
Ga0187220_102388533300017768SeawaterMEELKRLGQKMEQQMKDSLVFNEKTGFWYDKQDEESIYTEEGIRLSVYEDLKDTLNHLYSDCAY
Ga0187220_113480323300017768SeawaterMEELRKLGQKMEQQMKDSLRFDQKTGFWYDKEDQESTYTEEGIRLSVYEDLKDTLNYLYSDCAC
Ga0187221_111836433300017769SeawaterLQMEQQMKDSLGYDEKSGFWYDKEDEDSFYTEEGIRLAVYEDMKDTINFIYSDCAY
Ga0181394_104580923300017776SeawaterMEDLRKLGLKMEKEMKDSLGYDEKTGFWYDKEDEEVTFNEEGIRLSVYEDLKDTLNYLYSECAY
Ga0181395_109307113300017779SeawaterLGLQMEQQMKDSLIYDEKSGFWYDKEDEESIYTEEGIRLAVYEDMKDTLDNLYSECAY
Ga0181395_111461523300017779SeawaterMEDLRKLGLKMEKEMKDSLVYDEKTGFWYDKEDEESTYTEEGIRLSVYEDLKDTLNYLYSECAY
Ga0181424_1009655943300017786SeawaterLSAYNDVMEKLKELGLQMEQQMKDSLVYDEKNGFWYDKEDEESTYTEEGIRLAVYEDIKDILNYLYSECAY
Ga0181565_1022029433300017818Salt MarshMEELKKLGQKMEQQMKDSLRFDQKTGFWYDKEDEESIYTEEGIRLAVYEDLKDTLNLLYSECAYK
Ga0181606_1051470533300018048Salt MarshLGLQMEKEMKDSLKYDEKSGFWYDKEDEESYYTEEGIRLAVYEDLKDSLNHLY
Ga0181563_1070383923300018420Salt MarshMEELKKLGQKMEQQMKDSLRFDHKTGFWYDKEDEESIYTEEGIRLAVYEDLKDTLNLLYSECAYK
Ga0181568_1102321313300018428Salt MarshMDKLKQLGLQMEKEMKDSLVYDEKSGFWYDKEDEDVYYTEEGIRLAVYEDIKDSLNHLYSECAYY
Ga0206129_1024276313300020182SeawaterMDIMDKVKQSGLQMEQQMKDSLRYDKKSGFWYDWEDEDVYYTEEGIRLAVYEDLKDTLN
Ga0211651_1019321813300020408MarineMEELKKLGLKMEQQMKDSLVYDEKSGFWYDKEDQESTYTEEGIRLSVYEDIKDTLNYLYSECAY
Ga0211641_1010233423300020450MarineMEDLKKLGLKMEQQMKESLVYDEKRGFWYDKEDEESIYTEEGIRLSVYEDLKDTLNYLYSECAY
Ga0211676_1019992623300020463MarineMEDLNKLGIKMEQQMKDSLIYDEKKGFWYDKEDEESTYTEEGIRLAVYEDLKDSLNYIYSECAY
Ga0211676_1031772913300020463MarineMEDLKRLGIKMEQQMKDSLVYDEKSGFWYDKEDEESIYTEEGIRLAVYEDLKDTLNHLYSECAY
Ga0211577_1003402973300020469MarineMEDLKKLGLKMEKEMKDSLVYDEKMGFWYDKEDEESIYTEEGIRLSVYEDLKDTLNYLYSECAY
Ga0211577_1085405313300020469MarineLVIDVALSREIDYNYVMDKLKELGLQMEQQMKDSLGYDEKSGFWYDKEDEDSFYTEEGIRLAVYEDM
Ga0222717_1000844573300021957Estuarine WaterMEKLKQLGLQMEQQMKDSLGYDEKSGFWYDKEDEDVFYTEEGIRLAVYEDLKDSLNCLYSECAY
Ga0222717_1008382533300021957Estuarine WaterMEKLKQLGLQMEQQMKDSLGYDEKSGFWYDKEDEDVFYTEEGIRLAVYEDLKDSLNCLYSECAYK
Ga0222717_1013361343300021957Estuarine WaterMERLKQLGLVMEKEMKDSLVYDEKKGFWYDKEDEDSFYTEEGIRLAVYEDLKDSLNYHYSECAY
Ga0222716_1000836563300021959Estuarine WaterMEKEMKDSLVYDEKKGFWYDKEDEDSFYTEEGIRLAVYEDLKDSLNYHYSECAY
Ga0212024_104288023300022065AqueousMEEIEKLCLKMEKQMKASLTHNPEDGFWYDNHDPDVYYTDEGIRLAVYEDVKDALNTIYSECAYC
Ga0212021_112209413300022068AqueousCLKMEKQMKASLTHNPEDGFWYDNHDPDVYYTDEGIRLAVYEDVKDALNTIYSECAYC
(restricted) Ga0233426_1039558913300022920SeawaterTTTHIMEKLKQLGLQMEQQRKNSLRYDEKSGFWYDKEDEDVFYTEEGIRLAVYEDLKDTLNYLYSDCAC
(restricted) Ga0233432_1006069673300023109SeawaterMERLKQLGLQMEQQMKDSLRYDEKTGFWYDKEDEDVFYTEEGIRLAVYEDMKDTLNYLYSDCAC
Ga0228633_106509433300024228SeawaterMEKLKQLGLQMEQQMKDSLGYDEKSGFWYDKEDQESTYTEEGIRLAVYEDIKDTLNYLYSECAY
Ga0228665_100160983300024235SeawaterLSVYNDVMEKLKQLGLQMEQQMKDSLGYDEKSGFWYDKEDQESTYTEEGIRLAVYEDIKDTLNYLYSECAY
Ga0228661_111181813300024266SeawaterVMEKLKQLGLQMEQQMKDSLGYDEKSGFWYDKEDQESTYTEEGIRLAVYEDIKDTLNYLYSECAY
Ga0228656_105112313300024322SeawaterMDKLKELGLQMEQQMKDSLRFDQKTGFWYDKEDQESTYTEEGIRLSVYEDLK
Ga0228656_105817333300024322SeawaterMEQQMKDSLRFDQKTGFWYDKEDQESTYTEEGIRLSVYEDLKDTLNYLYSDCAC
Ga0228656_109269613300024322SeawaterMEELKKLGQKMEQQMKDSLRFDQKTGFWYDKEDQESTYTEEGIRLSVYEDLK
Ga0244775_1072479033300024346EstuarineMEKLKQLGSQMEQQMKDSLVYDDKSGFWYDKQDEDSFYTEEGIRLAVYEDLKDTLNYLYSDCAC
Ga0228632_116147033300024420SeawaterKMEQQMKDSLRFDQKTGFWYDKEDQESTYTEEGIRLSVYEDLKDTLNYLYSDCAY
Ga0209336_1000890683300025137MarineMDKLKQLGLQMEQQMKSTLNYNPKDGFWYDNDDLDVFYTEEGIRLAVYEDMKDTLNHLYSDCAY
Ga0209337_106921013300025168MarineVALIEKIGYNWGMDKLKELGLQMEQQMKDSLRFDHKTGFWHDWQDEDCYYTEDGIRLAVYEDMKDTINCLYSECAC
Ga0209252_116223123300025719MarineMDKLKELGKEMEDQMKDTLIFNDKDGFWYEKDDKYTFYTDEGIRLSVYEDLRDTLNYLYSDCAY
Ga0208405_100198943300026189MarineMEELKRLGIKMEQQMKDSLRFDQKTGFWYDKEDQESVYTEEGIRLSVYEDLKDTLNHLYSECAY
Ga0208798_103606723300027183EstuarineMEKLKQLGSQMEQQMKDSLVYDDKSGFWYDKQDENSFYTEEGIRLAVYEDLKDTLNYLYSDCAC
Ga0209090_1058162523300027813MarineMVNVEQLGLQMEREMKSTLTYNPKDGFWYDNDDLDTYYTDEGIRLAVYEDLKDTLNYLYSDCAY
Ga0257114_119042433300028196MarineLSAYNDVMDKLKQLGLQMEQQMKNSLGYDEKSGFWYDKEDEDVFYTEEGIRLAVYEDMKDTINFIYSDCAY
Ga0257110_128229013300028197MarineMDKLKQLGLQMEQQMKDSLRFDQKTGFWYDWEDEDSFYTEEGIRLAVYEDLKDTLNHLYSECVC
Ga0257121_100215153300028198MarineMDKLKELGLQMEQQMKDSLIYDEKSGFWYDKEDEESTYTEEGIRLSVYEDLKDTLNYLYSECAY
Ga0256413_102407713300028282SeawaterLKQLGLQMEQQMKDSLGYDEKSGFWYDKEDQESTYTEEGIRLAVYEDIKDTLNYLYSECA
Ga0315328_1001914773300031757SeawaterMEKIKKLGKEMEDQMKASLTYNPKDGFWYDNDDLDTYYTDEGIRLAVYEDIKDTLNYLYSDCAY
Ga0315332_1084782613300031773SeawaterMEELKKLGQKMEQQMKDSLRFDQKTGFWYDKEDEESTYTEEGIRLSVYEDLKDTLNLLYSDCAY
Ga0315331_1086261123300031774SeawaterMDKLKQLGLQMEQQMKDSLIYDQKTGFWYDKQDEESFYTQEGIRLAVYEDMKDTINYLYSDCAC
Ga0315316_1024102433300032011SeawaterMEDLKKLGKEMEDQMKDSLIYDEKSGFWYDKEDEESTYTEEGIRLTVYEDLRDTLNYLYSDCCY
Ga0315330_1052793233300032047SeawaterLVIDVALSREIEYNYVMDKLKELGLQMEQQMKDSLGYDEKTGFWYDKEDEEVTFNEEGIRLSVY
Ga0315315_1000665113300032073SeawaterMEQQMKATLTLNPKDGFWYDNDDLDTYYTDEGIRLAVYEDLKDTLNYLYSDCAY
Ga0315315_1188798923300032073SeawaterMEELKKLGQKMEQQMKDSLVFDEKTGFWYDKEDEESTYTEEGIRLSVYEDLKDTLNLLYSDCAY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.