 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F105329 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MKQRIEKWWDSFLSLKWWVQAIIIAVIAVGIHNYILH |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 74.00 % |
| % of genes near scaffold ends (potentially truncated) | 22.00 % |
| % of genes from short scaffolds (< 2000 bps) | 79.00 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (20.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF11351 | GTA_holin_3TM | 38.00 |
| PF08774 | VRR_NUC | 11.00 |
| PF12705 | PDDEXK_1 | 3.00 |
| PF00149 | Metallophos | 2.00 |
| PF00959 | Phage_lysozyme | 2.00 |
| PF03237 | Terminase_6N | 1.00 |
| PF05065 | Phage_capsid | 1.00 |
| PF01844 | HNH | 1.00 |
| PF06147 | DUF968 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.00 % |
| All Organisms | root | All Organisms | 41.00 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 1.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 20.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 19.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 16.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 13.00% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.00% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 5.00% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 3.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.00% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 2.00% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.00% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 1.00% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.00% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.00% |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 1.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.00% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 1.00% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300008740 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um, replicate a | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028883 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Acet-12 | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_1001549111 | 3300000115 | Marine | MKQKIEKWWDSFMELKWWLQAIIIVGITLAIHNWILH* |
| DelMOSum2011_101347203 | 3300000115 | Marine | MKQKIEKWWDSFLSLKWWVQVIIVAVIAVGIHNYILH* |
| DelMOWin2010_101029553 | 3300000117 | Marine | MKQRIEKWWDSFLSLKWWVQAIIIAVVAVGIHNYILH* |
| DelMOWin2010_101211562 | 3300000117 | Marine | MKQKIEKWWDSFLSLKWWVQVIIVAVIAVGIHNFILH* |
| DelMOWin2010_101482092 | 3300000117 | Marine | MKQRIEKWWDSFVSLKWWVQAIIIAVVAVGIHNYVLH* |
| BBAY92_100064156 | 3300000947 | Macroalgal Surface | MKQKIEKWWDSFLSLKWWVQAIIIAVVAVGIHNYILH* |
| BBAY92_100805665 | 3300000947 | Macroalgal Surface | MKERIEKWWDSFLSLKWWVQAIIIVLITIAVHNYILH* |
| BBAY92_101095522 | 3300000947 | Macroalgal Surface | MRERIEKWWDSFISLKWWVQAIIIVIITIAIHNWILH* |
| KVRMV2_1002012023 | 3300002231 | Marine Sediment | MRERIDKWWDSFVQLKWWIQAIIIVLITIGIHNWILH* |
| KVWGV2_103400631 | 3300002242 | Marine Sediment | KSERIDKMRERIEKWWDSFISLKWWVQAIIIVIITIAIHNWILH* |
| Ga0008649_100194517 | 3300005838 | Marine | MKQRIEKWWDSFLSLKWWVQAIIIAVVAIGIHNYILH* |
| Ga0075466_10318315 | 3300006029 | Aqueous | MKQKIEKWWDSFLSLKWWVQVIIIAVIAVGIHNFILH* |
| Ga0068500_12292631 | 3300006332 | Marine | MRERIDKWWDSFVQLKWWVQAIIIVAITIGIHHWILH* |
| Ga0098038_10453204 | 3300006735 | Marine | MKQRIEKWWDSFVSLKWWVQAIIIVLITIAVHNYILH* |
| Ga0098040_100276816 | 3300006751 | Marine | MRERIDKWWDSFVQLKWWIQAIIIIAITMGIHHWILH* |
| Ga0098044_11172683 | 3300006754 | Marine | MKERIEKWWDSFISLKWWIQAIIIVIITIAIHNWVLH* |
| Ga0098054_10366295 | 3300006789 | Marine | KMRERIDKWWDSFVQLKWWIQAIIIIAITMGIHHWILH* |
| Ga0098054_10689034 | 3300006789 | Marine | MKDRIERWWDSFAQLKWWIQAIIIMAMTIAIHHWILH* |
| Ga0098054_11942482 | 3300006789 | Marine | MKQRIEKWWDSFLSLKWWVQAIIIAVVAVGIHNYVLH* |
| Ga0070754_100971971 | 3300006810 | Aqueous | KMKQKIEKWWDSFLSLKWWVQVIIIAVIAVGIHNFILH* |
| Ga0070750_100573664 | 3300006916 | Aqueous | MKQKIEKWWDSFLSLKWWVQAIIIAVVAVGIHNYVLH* |
| Ga0070746_105212592 | 3300006919 | Aqueous | MKQKIEKWWDSFLSLKWWVQVIIIAVVAVGIHNFILH* |
| Ga0070748_11028513 | 3300006920 | Aqueous | MKQRIEKWWDSFVSLKWWVQAIIIAVVAVGIHNYILH* |
| Ga0098036_10664481 | 3300006929 | Marine | MKQRIEKWWDSFLSLKWWVQAIIIAVVAIGIHNYI |
| Ga0098036_11583872 | 3300006929 | Marine | MRDKIERWWDSFAQLKWWIQAIIIMAMTIAIHHWILH* |
| Ga0115663_100313420 | 3300008740 | Marine | MRERIDKWWDSFVQLKWWVQAIIIIAITMGIHHWILH* |
| Ga0102960_11951913 | 3300009000 | Pond Water | MKQKIEKWWDSFLSLKWWVQVIIIAVIAVGIHNYILH* |
| Ga0115566_104111781 | 3300009071 | Pelagic Marine | FDKMKQKIEKWWDSFLSLKWWVQVIIIAVIAVGIHNFILH* |
| Ga0115545_10102881 | 3300009433 | Pelagic Marine | KGGSMKQRIEKWWDSFLSLKWWVQAIIIAVVAVGIHNYVLH* |
| Ga0114932_102307093 | 3300009481 | Deep Subsurface | MRERIEKWWDSFISLKWWVQAIIIIIITIAIHNWILH* |
| Ga0114932_103093732 | 3300009481 | Deep Subsurface | MRERIEKWWDSFISLKWWIQAIIIVIITIAIHNWILH* |
| Ga0115011_100284947 | 3300009593 | Marine | MKERIEKWWDSFISLKWWVQAIIIVIITIAIHNWVLH* |
| Ga0114933_100897866 | 3300009703 | Deep Subsurface | MKQRIEKWWDSFISLKWWVQAIIIVLITIVVHNYILH* |
| Ga0098049_11486411 | 3300010149 | Marine | KQRIEKWWDSFVSLKWWVQAIIIVLITIAVHNYILH* |
| Ga0114934_100514593 | 3300011013 | Deep Subsurface | MRERIEKWWDSFISLKWWIQAIIIKKITIAIQNWILH* |
| Ga0160423_106921203 | 3300012920 | Surface Seawater | MKQRIEKWWDSFVSLKWWVQAIIIVLITIGVHNYILH* |
| Ga0163108_105627704 | 3300012950 | Seawater | MKDKIETWWDSFVQLKWWIQAIIIIAITMGIHHWILH* |
| Ga0163179_112684672 | 3300012953 | Seawater | MKQKIEKWWDSFMELKWWIQAIIIVGITLAIHNWILH* |
| Ga0181369_10294933 | 3300017708 | Marine | MKQRIEKWWDSFVSLKWWVQAIIIILITIGVNNYIPH |
| Ga0181403_10247814 | 3300017710 | Seawater | MKQRIEKWWDSFVSLKWWVQAIIIAVIAVGIHNYILH |
| Ga0181416_10858181 | 3300017731 | Seawater | KGGSMKQRIEKWWDSFVSLKWWVQAIIIAVVAVGIHNYILH |
| Ga0181415_11278273 | 3300017732 | Seawater | MKQRIEKWWDSFVSLTWWVQAIIIAVVAVGIHNYVLH |
| Ga0181428_10679231 | 3300017738 | Seawater | SMKQRIEKWWDSFVSLKWWVQAIIIAVIAVGIHNYILH |
| Ga0181421_10840463 | 3300017741 | Seawater | MTQKIEKWWDSFMELKWWIQAIIIVGITLAIHNWILH |
| Ga0181397_11062651 | 3300017744 | Seawater | ANKMKQKIEKWWDSFLSLKWWVQAIIIAVIAVGIHNYILH |
| Ga0181427_10648381 | 3300017745 | Seawater | SSKMKQRIENWWGSFVELKWWVQAIIIVAITIGIHHWILH |
| Ga0181389_10933721 | 3300017746 | Seawater | RFNQVKGGSMKQRIEKWWDSFVSLKWWVQAIIIAVVAVGIHNYILH |
| Ga0181405_10906354 | 3300017750 | Seawater | KQRIEKWWDSFVSLKWWVQAIIIAVIAVGIHNYILH |
| Ga0181400_10991623 | 3300017752 | Seawater | MKQRIEKWWDSFLSLKWWVQAIIIAVIAVGIHNYILH |
| Ga0181411_10946532 | 3300017755 | Seawater | MKERIEKWWDSFMELKWWIQAIIIVGITLAIHNWILH |
| Ga0181382_11115111 | 3300017756 | Seawater | KSKGANKMKQKIEKWWDSFLSLKWWVQVIIIAVIAVGIHNFILH |
| Ga0181420_11735172 | 3300017757 | Seawater | MKERIEKWWDSFISLKWWIQAIIIVIITIAIHNWILH |
| Ga0181408_11314291 | 3300017760 | Seawater | RSSKMKQRIENWWGSFVELKWWVQAIIIVAITIGIHHWILH |
| Ga0187221_10117191 | 3300017769 | Seawater | MKQRIENWWDSFLSLKWWVQAIIIAVVAIGIHNYILH |
| Ga0181425_10584423 | 3300017771 | Seawater | MKQRIENWWGSFVELKWWVQAIIIVAITIGIHHWILH |
| Ga0181425_10609404 | 3300017771 | Seawater | MKQRIEKWWDSFLSLQWWVQAIIIAVVAVGIHNYILH |
| Ga0181430_12107631 | 3300017772 | Seawater | KRINQVKGGSMKQRIEKWWDSFVSLKWWVQAIIIAVVAVGIHNYILH |
| Ga0181607_106374901 | 3300017950 | Salt Marsh | MKQKIEKWWDSFLSLKWWVQVIIIAVVAVGIHNFILH |
| Ga0194023_10398803 | 3300019756 | Freshwater | MKQKIEKWWDSFLSLKWWVQVIIVAVIAVGIHNYILH |
| Ga0211476_100893965 | 3300020381 | Marine | MKQRIEKWWDSFISLKWWVQAIIIVLITIVVHNYILH |
| Ga0211659_101410312 | 3300020404 | Marine | MKQRIEKWWDSFVSLKWWVQAIIIVLITIAVHNYILH |
| Ga0211653_101687491 | 3300020421 | Marine | MKQRIEKWWDSFLSLKWWVQAIIIAVVAVGIHNYVLH |
| Ga0211576_105771263 | 3300020438 | Marine | MKQRIEKWWDSFLSLKWWVQAIIIAVVAIGIHNYILH |
| Ga0211558_100880114 | 3300020439 | Marine | MKQKIEKWWDSFISMKWWIQVIIIAVVAVGIHNFILH |
| Ga0211577_107833574 | 3300020469 | Marine | VTRFNQVKGGSMKQRIEKWWDSFVSLKWWVQAIIIAVVAVGIHNYILH |
| Ga0211579_103437663 | 3300020472 | Marine | MRERIEKWWDSFISLKWWIQAIIIVIITIAIHNWILH |
| Ga0211541_104954022 | 3300020475 | Marine | MKQKIEKWWDSFMELKWWIQAIIIVGITVAIHNWILH |
| Ga0222717_100548803 | 3300021957 | Estuarine Water | MKQKIEKWWDSFLSLKWWVQAIIIAVIAVGIHNYILH |
| Ga0212025_10330804 | 3300022057 | Aqueous | MKQKIEKWWDSFLSLKWWVQVIIIAVIAVGIHNFILH |
| Ga0212021_11020562 | 3300022068 | Aqueous | MKQKIEKWWDSFMELKWWLQAIIIVGITLAIHNWILH |
| Ga0196889_10840202 | 3300022072 | Aqueous | MKQRIEKWWDSFLSLKWWVQAIIIAVVAIGIHNYVLH |
| Ga0224906_10165232 | 3300022074 | Seawater | MKQKIEKWWDSFLSLKWWVQAIIIAIIAVGIHNYILH |
| Ga0224906_11902913 | 3300022074 | Seawater | MKQRIEKWWDSFVSLKWWVQAIIIAVVAVGIHNYVLH |
| Ga0209992_1000095833 | 3300024344 | Deep Subsurface | MRERIEKWWDSFISLKWWVQAIIIIIITIAIHNWILH |
| Ga0208011_10188436 | 3300025096 | Marine | MRERIDKWWDSFVQLKWWIQAIIIIAITMGIHHWILH |
| Ga0208790_10539583 | 3300025118 | Marine | MKERIEKWWDSFISLKWWIQAIIIVIITIAIHNWVLH |
| Ga0208919_11911032 | 3300025128 | Marine | MRDKIERWWDSFAQLKWWIQAIIIMAMTIAIHHWILH |
| Ga0208299_10299237 | 3300025133 | Marine | MKDRIERWWDSFAQLKWWIQAIIIMAMTIAIHHWILH |
| Ga0208148_11229413 | 3300025508 | Aqueous | TRFNQVKGGSMKQRIEKWWDSFLSLKWWVQAIIIAVVAVGIHNYVLH |
| Ga0208149_10630901 | 3300025610 | Aqueous | DKMKQKIEKWWDSFLSLKWWVQVIIIAVIAVGIHNFILH |
| Ga0208643_10590015 | 3300025645 | Aqueous | MKQRIEKWWDSFVSLKWWVQAIIIAVVAVGIHNYILH |
| Ga0208162_11421141 | 3300025674 | Aqueous | MKQKIEKWWDSFLSLKWWVQVIIVAVIAVGIHNFILH |
| Ga0208899_10474794 | 3300025759 | Aqueous | MKQKIEKWWDSFLSLKWWVQVIIIAVIAVGIHNFIILH |
| Ga0209404_101172183 | 3300027906 | Marine | MKERIEKWWDSFISLKWWVQAIIIVIITIAIHNWVLH |
| Ga0256382_11230852 | 3300028022 | Seawater | MRERIDKWWDSFVQLKWWIQAIIIVLITIGIHNWILH |
| Ga0265306_108412251 | 3300028598 | Sediment | FMKQKIEKWWDSFLSLKWWVQVIIIAVIAVGIHNFILH |
| Ga0272443_103267014 | 3300028883 | Marine Sediment | CMKQRIEKWWDSFLSLKWWVQAIIIAVVAVGIHNYVLH |
| Ga0183683_100103625 | 3300029309 | Marine | MKQRIEKWWDSFVSLKWWVQAIIIVLITIGVHNYILH |
| Ga0183683_100197814 | 3300029309 | Marine | MKQRLEKWWDQFVSLKWWVQAVIIVIAVLLIHSFVMH |
| Ga0183683_10102985 | 3300029309 | Marine | MKQRIEKWWDSFVSLKWWVQAIIIILITIGVHNYILH |
| Ga0183683_10428284 | 3300029309 | Marine | MKDNIEKWWDSFLSLKWWVQALIIVIITVAVHNYILH |
| Ga0183683_10447221 | 3300029309 | Marine | MKQNIEKWWDSFLSLKWWVQALIIVIITVAVHNYILH |
| Ga0183748_10257305 | 3300029319 | Marine | MKERIEKWWDSFVSLKWWVQAIIIVLITIGVHNYILH |
| Ga0183755_100042813 | 3300029448 | Marine | MKERIEKWWDSFMELKWWIQAIIIVGITIGIHNWILH |
| Ga0183755_100439720 | 3300029448 | Marine | MKQKIEKWWDSFISLKWWVQAIIIVLITIVVHNYILH |
| Ga0183755_10280203 | 3300029448 | Marine | MKQRIEKWWDSFISLKWWVQAMIIAVVAVGIHNYILH |
| Ga0183755_10951432 | 3300029448 | Marine | NQRSNKMKQKIEKWWDSFMELKWWLQAIIIVGITLAIHNWILH |
| Ga0183757_100024331 | 3300029787 | Marine | MKQRIEKWWDSFLSLKWWVQAIIIVLITIAVHNYILH |
| Ga0310344_116257392 | 3300032006 | Seawater | MRDKIERWWDSFVQLKWWVQAIIIMAMTIAIHHWILH |
| Ga0315330_106436652 | 3300032047 | Seawater | MKQKIEKWWDSFMELKWWIQAIIIVGITLAIHNWILH |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |