| Basic Information | |
|---|---|
| Family ID | F105315 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MEIALIVFILLVGIGAVVSGRDSRIDETARRRRYLG |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 23.00 % |
| % of genes near scaffold ends (potentially truncated) | 16.00 % |
| % of genes from short scaffolds (< 2000 bps) | 83.00 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (15.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (24.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.12% β-sheet: 0.00% Coil/Unstructured: 46.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF02737 | 3HCDH_N | 26.00 |
| PF03466 | LysR_substrate | 25.00 |
| PF00126 | HTH_1 | 18.00 |
| PF00999 | Na_H_Exchanger | 5.00 |
| PF02803 | Thiolase_C | 3.00 |
| PF07690 | MFS_1 | 2.00 |
| PF00171 | Aldedh | 2.00 |
| PF13487 | HD_5 | 1.00 |
| PF03320 | FBPase_glpX | 1.00 |
| PF00486 | Trans_reg_C | 1.00 |
| PF02080 | TrkA_C | 1.00 |
| PF00848 | Ring_hydroxyl_A | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 26.00 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 26.00 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 26.00 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 26.00 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 26.00 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 26.00 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 26.00 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 5.00 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 5.00 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 5.00 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 5.00 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 5.00 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 3.00 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 2.00 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 2.00 |
| COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 2.00 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 2.00 |
| COG1494 | Fructose-1,6-bisphosphatase/sedoheptulose 1,7-bisphosphatase or related protein | Carbohydrate transport and metabolism [G] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.00 % |
| Unclassified | root | N/A | 38.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090009|LWAnN_F624WLL02JB24P | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 2124908043|A2_c1_ConsensusfromContig65588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
| 2140918007|ConsensusfromContig102239 | Not Available | 960 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_100878069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 696 | Open in IMG/M |
| 3300005548|Ga0070665_100119615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2636 | Open in IMG/M |
| 3300005833|Ga0074472_11430939 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300006046|Ga0066652_101177445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 726 | Open in IMG/M |
| 3300006354|Ga0075021_10066637 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300006606|Ga0074062_12093154 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300006953|Ga0074063_13793617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1849 | Open in IMG/M |
| 3300007521|Ga0105044_10175267 | All Organisms → cellular organisms → Bacteria | 2218 | Open in IMG/M |
| 3300009177|Ga0105248_13084269 | Not Available | 530 | Open in IMG/M |
| 3300009527|Ga0114942_1442787 | Not Available | 529 | Open in IMG/M |
| 3300009551|Ga0105238_11561407 | Not Available | 689 | Open in IMG/M |
| 3300009553|Ga0105249_12805349 | Not Available | 559 | Open in IMG/M |
| 3300009870|Ga0131092_10140562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2689 | Open in IMG/M |
| 3300010403|Ga0134123_10844966 | Not Available | 915 | Open in IMG/M |
| 3300011107|Ga0151490_1665240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 520 | Open in IMG/M |
| 3300012212|Ga0150985_106572930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
| 3300012212|Ga0150985_107666737 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012469|Ga0150984_105524012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300012668|Ga0157216_10087865 | Not Available | 1518 | Open in IMG/M |
| 3300012903|Ga0157289_10087833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 866 | Open in IMG/M |
| 3300012915|Ga0157302_10148069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 795 | Open in IMG/M |
| 3300012985|Ga0164308_10656295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 899 | Open in IMG/M |
| 3300013296|Ga0157374_11155907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 795 | Open in IMG/M |
| 3300014322|Ga0075355_1076602 | Not Available | 795 | Open in IMG/M |
| 3300014322|Ga0075355_1104924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 706 | Open in IMG/M |
| 3300014325|Ga0163163_10291700 | Not Available | 1683 | Open in IMG/M |
| 3300014326|Ga0157380_11308017 | Not Available | 772 | Open in IMG/M |
| 3300014968|Ga0157379_12586038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 508 | Open in IMG/M |
| 3300014969|Ga0157376_11349156 | Not Available | 744 | Open in IMG/M |
| 3300015084|Ga0167654_1044106 | Not Available | 631 | Open in IMG/M |
| 3300015163|Ga0167665_1004489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2943 | Open in IMG/M |
| 3300015189|Ga0167667_1003608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5077 | Open in IMG/M |
| 3300015189|Ga0167667_1003713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4992 | Open in IMG/M |
| 3300015209|Ga0167629_1086420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 976 | Open in IMG/M |
| 3300015360|Ga0163144_10061313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6490 | Open in IMG/M |
| 3300015360|Ga0163144_10898076 | Not Available | 870 | Open in IMG/M |
| 3300015371|Ga0132258_14005304 | Not Available | 1000 | Open in IMG/M |
| 3300017789|Ga0136617_10006826 | All Organisms → cellular organisms → Bacteria | 10179 | Open in IMG/M |
| 3300017792|Ga0163161_11680036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 562 | Open in IMG/M |
| 3300017965|Ga0190266_10519804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 699 | Open in IMG/M |
| 3300018076|Ga0184609_10579706 | Not Available | 505 | Open in IMG/M |
| 3300018469|Ga0190270_11045369 | Not Available | 846 | Open in IMG/M |
| 3300018481|Ga0190271_10053581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3455 | Open in IMG/M |
| 3300018481|Ga0190271_10768543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1087 | Open in IMG/M |
| 3300020057|Ga0163151_10041552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3448 | Open in IMG/M |
| 3300020195|Ga0163150_10181689 | Not Available | 1153 | Open in IMG/M |
| 3300021329|Ga0210362_1574039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 671 | Open in IMG/M |
| 3300021363|Ga0193699_10466049 | Not Available | 519 | Open in IMG/M |
| 3300021445|Ga0182009_10334930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 770 | Open in IMG/M |
| 3300022894|Ga0247778_1236535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 517 | Open in IMG/M |
| 3300022904|Ga0247769_1141611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 604 | Open in IMG/M |
| (restricted) 3300023208|Ga0233424_10095518 | Not Available | 1294 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10457553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 516 | Open in IMG/M |
| 3300025924|Ga0207694_11135352 | Not Available | 661 | Open in IMG/M |
| 3300025927|Ga0207687_10805947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300025972|Ga0207668_11639488 | Not Available | 581 | Open in IMG/M |
| 3300026118|Ga0207675_102329334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 549 | Open in IMG/M |
| 3300027831|Ga0209797_10076828 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300027843|Ga0209798_10175263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1067 | Open in IMG/M |
| 3300027843|Ga0209798_10452081 | Not Available | 594 | Open in IMG/M |
| 3300027850|Ga0209591_10203875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1578 | Open in IMG/M |
| 3300027870|Ga0209023_10080134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2369 | Open in IMG/M |
| 3300027870|Ga0209023_10355066 | Not Available | 916 | Open in IMG/M |
| 3300027894|Ga0209068_10165007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1205 | Open in IMG/M |
| 3300027897|Ga0209254_10002705 | All Organisms → cellular organisms → Bacteria | 16138 | Open in IMG/M |
| 3300027915|Ga0209069_10146426 | Not Available | 1172 | Open in IMG/M |
| 3300028379|Ga0268266_10763300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 934 | Open in IMG/M |
| 3300028420|Ga0210366_10419982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 562 | Open in IMG/M |
| 3300028732|Ga0302264_1043949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1038 | Open in IMG/M |
| 3300028755|Ga0307316_10329019 | Not Available | 561 | Open in IMG/M |
| 3300028855|Ga0302257_1115271 | Not Available | 599 | Open in IMG/M |
| 3300029990|Ga0311336_10952237 | Not Available | 744 | Open in IMG/M |
| 3300030114|Ga0311333_10111914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2047 | Open in IMG/M |
| 3300030114|Ga0311333_10257866 | Not Available | 1375 | Open in IMG/M |
| 3300030336|Ga0247826_11492481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 548 | Open in IMG/M |
| 3300031170|Ga0307498_10439360 | Not Available | 521 | Open in IMG/M |
| 3300031170|Ga0307498_10471594 | Not Available | 508 | Open in IMG/M |
| 3300031366|Ga0307506_10151230 | Not Available | 814 | Open in IMG/M |
| 3300031521|Ga0311364_11743949 | Not Available | 613 | Open in IMG/M |
| 3300031726|Ga0302321_100289896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1748 | Open in IMG/M |
| 3300031834|Ga0315290_10054726 | All Organisms → cellular organisms → Bacteria | 3251 | Open in IMG/M |
| 3300031834|Ga0315290_10198113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1745 | Open in IMG/M |
| 3300031834|Ga0315290_10355569 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300031834|Ga0315290_10880704 | Not Available | 761 | Open in IMG/M |
| 3300031873|Ga0315297_10589415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 934 | Open in IMG/M |
| 3300031902|Ga0302322_103278129 | Not Available | 555 | Open in IMG/M |
| 3300031997|Ga0315278_10824111 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300031997|Ga0315278_11082738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
| 3300032143|Ga0315292_10378910 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300032164|Ga0315283_10138647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2586 | Open in IMG/M |
| 3300032164|Ga0315283_10141175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2563 | Open in IMG/M |
| 3300032164|Ga0315283_10865729 | Not Available | 964 | Open in IMG/M |
| 3300032256|Ga0315271_10155773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1795 | Open in IMG/M |
| 3300032275|Ga0315270_10436723 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300032397|Ga0315287_10765226 | Not Available | 1137 | Open in IMG/M |
| 3300032516|Ga0315273_11766823 | Not Available | 746 | Open in IMG/M |
| 3300034965|Ga0370497_0040727 | Not Available | 1007 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 15.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.00% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 8.00% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 6.00% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 3.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 2.00% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.00% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 1.00% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.00% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.00% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.00% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090009 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrate | Environmental | Open in IMG/M |
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015084 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015163 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1b, glacier snout) | Environmental | Open in IMG/M |
| 3300015189 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine) | Environmental | Open in IMG/M |
| 3300015209 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
| 3300020195 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IB | Environmental | Open in IMG/M |
| 3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022894 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5 | Environmental | Open in IMG/M |
| 3300022904 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L166-409R-6 | Environmental | Open in IMG/M |
| 3300023208 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG | Environmental | Open in IMG/M |
| 3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028732 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028855 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LWAnN_06927680 | 2088090009 | Freshwater Sediment | MEIALIVFILLVGLGAVTSGRDSRIDENARRRRYLG |
| A2_c1_00722170 | 2124908043 | Soil | MEIALIIFILLVGIGAVTIGRDSRIDESARRRRYLG |
| A_all_C_00547390 | 2140918007 | Soil | MAIAVVLFIVLVAVGSVLWGRDSRIDETDRRRRYLG |
| JGIcombinedJ13530_1008780691 | 3300001213 | Wetland | MIRPMEIAILLFIVLVGIGAVLAGADSRIDESARRRRYLG* |
| Ga0070665_1001196152 | 3300005548 | Switchgrass Rhizosphere | MEIAVIVFILVVGIGAVVSGRDSRIDETARRRRYLG* |
| Ga0074472_114309392 | 3300005833 | Sediment (Intertidal) | MEIALLVFILLVGIAAVTSGRDSRIDENARRRRYLG* |
| Ga0066652_1011774453 | 3300006046 | Soil | MEIALIVFILLVGIGALVSGRDSRIDETARRRRYLG* |
| Ga0075021_100666372 | 3300006354 | Watersheds | MAFALIIFIVLVGLGAVLGGRDSRIDDVARRRRYLG* |
| Ga0074062_120931542 | 3300006606 | Soil | MAFALIIFIVLVGLGAALVGRDSRVDEVARRRRYLG* |
| Ga0074063_137936173 | 3300006953 | Soil | METALIVFMLLVGPLAALFGRDSRIDEKGRRQHYLG* |
| Ga0105044_101752672 | 3300007521 | Freshwater | MEIALIVFIVLVAAGSVVAGKDSRIDESARRRRYLG* |
| Ga0105248_130842692 | 3300009177 | Switchgrass Rhizosphere | MEIALIVFILLVGIGAVLAGRDSRIDEKARTRRYLG* |
| Ga0114942_14427872 | 3300009527 | Groundwater | MEIALIVFIVLVAVGSVLAGKDSRIDESARRRRYLG* |
| Ga0105238_115614072 | 3300009551 | Corn Rhizosphere | MEIALIVFILLVGIGAVVAGRDSRIDETARRRRYLG* |
| Ga0105249_128053492 | 3300009553 | Switchgrass Rhizosphere | MEIALIVFILLVGLGAVAAGRDSRIDETARRRRYLG* |
| Ga0131092_101405623 | 3300009870 | Activated Sludge | MEIALIVFILLVGPLAALYGRDSRIDERGRRQRYLG* |
| Ga0134123_108449662 | 3300010403 | Terrestrial Soil | MEIALIVFILLVGIGAVLSGRDSRIDEAARRRRYLG* |
| Ga0151490_16652402 | 3300011107 | Soil | MEIALIVFILLVGIGAVVSGRDSRIDEAARRRRYLG* |
| Ga0150985_1065729302 | 3300012212 | Avena Fatua Rhizosphere | MEIALIVFIVLVAIGAVTSGRDSRIDEKARMRRYLG* |
| Ga0150985_1076667373 | 3300012212 | Avena Fatua Rhizosphere | PILEIALIVFILLVGIGAVVAGRDSRIDETARRRRYLG* |
| Ga0150984_1055240123 | 3300012469 | Avena Fatua Rhizosphere | GIALIVLILLIGPLAVLYGRDSRIDERGRRERYLG* |
| Ga0157216_100878652 | 3300012668 | Glacier Forefield Soil | MIHDDHHVVMAIALIVLILVVGPLAVLLGSDSRIDETSRRRRYLG* |
| Ga0157289_100878332 | 3300012903 | Soil | MEIAVIVFILVVGIGAVVSGRDSRIDEAARRRRYLG* |
| Ga0157302_101480691 | 3300012915 | Soil | YLLSHHLRMEIALIVFILLVGIGAVLAGRDSRIDEKARTRRYLG* |
| Ga0164308_106562953 | 3300012985 | Soil | MEIALIVFILFVGIGAVAFGRDSRIDETARRRRYLG* |
| Ga0157374_111559073 | 3300013296 | Miscanthus Rhizosphere | MEIAVIVFILVVGIGAVVSGRDSRIDETARRRRCLG* |
| Ga0075355_10766022 | 3300014322 | Natural And Restored Wetlands | MEIAMLLFIVLVGIGAVLAGADSRIDESARRRRYLG* |
| Ga0075355_11049241 | 3300014322 | Natural And Restored Wetlands | RPMEIVMLLFIVLVGIGAVFAGADSRIDESARRRRYLG* |
| Ga0163163_102917003 | 3300014325 | Switchgrass Rhizosphere | MEIALIVFILLVGLGAVFAGRDSRIDETARRRRYLG* |
| Ga0157380_113080172 | 3300014326 | Switchgrass Rhizosphere | MEIALIVFILLVGIGAVVGGRDSRIDETARRRRYLG* |
| Ga0157379_125860382 | 3300014968 | Switchgrass Rhizosphere | MEIALIVFILIVGIGAVVAGRDSRIDETARRRRYLG* |
| Ga0157376_113491562 | 3300014969 | Miscanthus Rhizosphere | MEIALIVFILLVGIGAVFAGRDSRIDETARRRRYLG* |
| Ga0167654_10441061 | 3300015084 | Glacier Forefield Soil | MEIAVIVFIVLVALGAVTSGRDSRIDEAARRRRYLG* |
| Ga0167665_10044895 | 3300015163 | Glacier Forefield Soil | MEIVLIVFILLVGIGAVVSGRDSRIDETARRRRYLG* |
| Ga0167667_10036082 | 3300015189 | Glacier Forefield Soil | MEIALIVFIVLVAVGSVYAGKDSRIDESARRRRYLG* |
| Ga0167667_10037136 | 3300015189 | Glacier Forefield Soil | MEIALIVFIVLVALGSVVAGKDSRIDESARRRRYLG* |
| Ga0167629_10864202 | 3300015209 | Glacier Forefield Soil | MEIALIVFIVLVAIGAVTSGRDSRIDETARRRRYLG* |
| Ga0163144_100613135 | 3300015360 | Freshwater Microbial Mat | MEIALLVFIILVALGSVFAGKDSRIDESARGRRYLG* |
| Ga0163144_108980763 | 3300015360 | Freshwater Microbial Mat | MEIALIVFIVLVAAGSVVAGKDSRIDELARRRRYLG* |
| Ga0132258_140053042 | 3300015371 | Arabidopsis Rhizosphere | MEIALIVFIVLVGIGAVVSGRDSRIDEKARTRRYLG* |
| Ga0136617_100068262 | 3300017789 | Polar Desert Sand | MVAEREDERMELVLLGFLLLVGPLAVVFGRDSRIDEVDRRRRYLG |
| Ga0163161_116800362 | 3300017792 | Switchgrass Rhizosphere | MEIAVIVFILVVGIGAVVSGRDSRIDETARRRRYLG |
| Ga0190266_105198043 | 3300017965 | Soil | MEIALIVFILLVGIGAVVSGRDSRIDETARRRRYLG |
| Ga0184609_105797061 | 3300018076 | Groundwater Sediment | MEIALIILLLLIGPLAALGGRDSRIDEAARRRHYLG |
| Ga0190270_110453692 | 3300018469 | Soil | MEIALIVFILLVGIGAVVGGRDSRIDETARRRRYLG |
| Ga0190271_100535812 | 3300018481 | Soil | MEIALIVFIVLVALGSVFAGKDSRLDESARRRRYLG |
| Ga0190271_107685432 | 3300018481 | Soil | MEIALIVFIVLVGIGAVVSGRDSRIDETARRRRYLG |
| Ga0163151_100415523 | 3300020057 | Freshwater Microbial Mat | MEIALLVFIILVALGSVFAGKDSRIDESARGRRYLG |
| Ga0163150_101816892 | 3300020195 | Freshwater Microbial Mat | MEIALLVFIILVALGSVLAGKDSRIDESARGRRYLG |
| Ga0210362_15740392 | 3300021329 | Estuarine | MGIALLVFILLVGIAAVTSGRDSRIDENARRRRYLG |
| Ga0193699_104660492 | 3300021363 | Soil | MEIALIVFILVVGIGAVVAGRDSRIDETARRRRYLG |
| Ga0182009_103349302 | 3300021445 | Soil | MEIALIVFILVVGIGAVVSGRDSRIDEAARRRRYLG |
| Ga0247778_12365352 | 3300022894 | Plant Litter | MEIALIVFILLVGLGAVFAGRDSRIDETARRRRYLG |
| Ga0247769_11416111 | 3300022904 | Plant Litter | EIALIVFILLVGIGAVVSGRDSRIDEAARRRRYLG |
| (restricted) Ga0233424_100955182 | 3300023208 | Freshwater | MGMEIALIVFLLLVGPLALLGGRDSRIDEAERRRHYLG |
| (restricted) Ga0233425_104575532 | 3300024054 | Freshwater | MEIALIVFLLLVGPLALLGGRDSRIDEAERRRHYLG |
| Ga0207694_111353522 | 3300025924 | Corn Rhizosphere | MEIALIVFILLVGIGAVVAGRDSRIDETARRRRYLG |
| Ga0207687_108059472 | 3300025927 | Miscanthus Rhizosphere | MEIAVIVFILVVGIGAVVSGRDSRIDEAARRRRYLG |
| Ga0207668_116394882 | 3300025972 | Switchgrass Rhizosphere | MEIALIVFIVLVAVGAVFSGRDSRIDEKARQRRYLG |
| Ga0207675_1023293343 | 3300026118 | Switchgrass Rhizosphere | ADMEIAVIVFILVVGIGAVVSGRDSRVDEAARRRRYLG |
| Ga0209797_100768282 | 3300027831 | Wetland Sediment | MEIALILFILLVGIAAVTSGRDSRIDENARRRRYLG |
| Ga0209798_101752631 | 3300027843 | Wetland Sediment | MEIALLVFILLVGIAAVTSGRDSRIDENARRRRYLG |
| Ga0209798_104520812 | 3300027843 | Wetland Sediment | MEIALLLFVLLVAIGAVASGSDSRIDEAARRRRYLG |
| Ga0209591_102038753 | 3300027850 | Freshwater | MDIALIVFIVLVAAGSVVAGKDSRIDESARRRRYLG |
| Ga0209023_100801343 | 3300027870 | Freshwater And Sediment | MEIALIVFILLVGIGAVVSGRDSRIDEIARRRRYLG |
| Ga0209023_103550663 | 3300027870 | Freshwater And Sediment | MQIALIVFIVLVAVGSVFAGKDSRIDESARRRRYLG |
| Ga0209068_101650071 | 3300027894 | Watersheds | MALALIIFIVIVGLGAVRGGRDSRIDEVARRRRYLG |
| Ga0209254_100027055 | 3300027897 | Freshwater Lake Sediment | MEIALLVFILLVGLAAVTSGRDSRIDENARRRRYLG |
| Ga0209069_101464262 | 3300027915 | Watersheds | MMRGMEIALIVFILLVGIGAVVSGRDSRIDETARRRRYLG |
| Ga0268266_107633003 | 3300028379 | Switchgrass Rhizosphere | AAMEIALIVFILLVGIGAVVSGRDSRIDEAARRRRYLG |
| Ga0210366_104199822 | 3300028420 | Estuarine | MEIALIVFLVLVTVGAVLVGKDSRIDEASRRRRYLG |
| Ga0302264_10439492 | 3300028732 | Fen | MEIAVIVFIVLVGLGAVLAGADSRIDEAARRRRYLG |
| Ga0307316_103290192 | 3300028755 | Soil | SSHHVDMEIVLLLFILLVGVGAVLGGRDSRIDEVARRRRYHG |
| Ga0302257_11152712 | 3300028855 | Fen | MRLMEIALIVFILLVGIGAVTVGRDSRIDEAARRRRYLG |
| Ga0311336_109522371 | 3300029990 | Fen | LIVPDRHTVSMEIALIVFMLLVGPLAVLFGHDSRIDERGRRQHYLG |
| Ga0311333_101119142 | 3300030114 | Fen | MMRLMEIALIVFILLVGIGAVTVGRDSRIDEAARRRRYLG |
| Ga0311333_102578662 | 3300030114 | Fen | MEIALIVFMLLVGPLAVLFGHDSRIDERGRRQHYLG |
| Ga0247826_114924812 | 3300030336 | Soil | MEIALIVFILLVGIGAVLSGRDSRIDEAARRRRYLG |
| Ga0307498_104393602 | 3300031170 | Soil | MEIAVIVFILLVGLAAVTVGRDSRIDETARRRRYLG |
| Ga0307498_104715941 | 3300031170 | Soil | IHVRHTVSMEIALIVLFLLVGPAAILAGRDSRIDEAGRRRRYLG |
| Ga0307506_101512303 | 3300031366 | Soil | MGIALIVFIVLVGIGAVTSGRDSRIDETARQRRYLG |
| Ga0311364_117439492 | 3300031521 | Fen | MRDMEIALMVFILLVGIGAVTVGRDSRIDETARRRRYLG |
| Ga0302321_1002898964 | 3300031726 | Fen | MEIALIVFILLVGIGAVTVGRDSRIDETARRRRYLG |
| Ga0315290_100547264 | 3300031834 | Sediment | MEIALIVFVLLVGLGAVAFGSDSRIDENARRRRYLG |
| Ga0315290_101981132 | 3300031834 | Sediment | MEIAVIIFIVLVGLGSVAFGRDSRIDENARRRRYLG |
| Ga0315290_103555692 | 3300031834 | Sediment | MEIALIVFILLVGIGAVVFGRDSRIDEMARRRRYLG |
| Ga0315290_108807042 | 3300031834 | Sediment | MEIALIVFVLLVGLGAVAFGTDSRIDENARRRRYLG |
| Ga0315297_105894152 | 3300031873 | Sediment | MEIALIVFIVLVAVGSVFAGKDSRIDESARRRRYLG |
| Ga0302322_1032781291 | 3300031902 | Fen | LIIPDRHTVSMEIALIVFMLLVGPLAVLFGHDSRIDERGRRQHYLG |
| Ga0315278_108241112 | 3300031997 | Sediment | MEIAVIIFILLVGLGSVAFGRDSRIDENARRRRYLG |
| Ga0315278_110827381 | 3300031997 | Sediment | EIALIVFIVLVAVGSVFAGKDSRIDESARRRRYLG |
| Ga0315292_103789102 | 3300032143 | Sediment | MEIALIVFVLLIGLVAVTVGSDSRIDENARRRRYLG |
| Ga0315283_101386472 | 3300032164 | Sediment | MEIALIVFILLVGIAAVTSGRDSRIDENARRRRYLG |
| Ga0315283_101411753 | 3300032164 | Sediment | MEIALIVFILLVGLGAVVSGRDSRIDENARRRRYLG |
| Ga0315283_108657291 | 3300032164 | Sediment | SAHMEIALIVFVLLVGLGAVAFGTDSRIDENARRRRYLG |
| Ga0315271_101557733 | 3300032256 | Sediment | MEIALIVFVLLVAVGSIFAGKDSRIDETARTRRYLG |
| Ga0315270_104367232 | 3300032275 | Sediment | MEIAVIIFILLVGLGSVAFGRDSRIDENARRCRYLG |
| Ga0315287_107652262 | 3300032397 | Sediment | MEIALIVFVLLIGLAAVTIGSDSRIDENARRRRYLG |
| Ga0315273_117668232 | 3300032516 | Sediment | MEIALIVFILLVGIGAVVFGRDSRIDEAARRRRYLG |
| Ga0370497_0040727_252_389 | 3300034965 | Untreated Peat Soil | MIPVRHTVSMEIALIVFMLLVGPVALLLGRDSRIDEAGRRRNYLG |
| ⦗Top⦘ |