 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F105286 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKSTASKPKLPRGRRGKKANSAEINQATAAEFEREGMGVAPKE |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 1.00 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (16.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.68% β-sheet: 0.00% Coil/Unstructured: 87.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 44.00 |
| PF00664 | ABC_membrane | 13.00 |
| PF13561 | adh_short_C2 | 9.00 |
| PF00578 | AhpC-TSA | 5.00 |
| PF08837 | DUF1810 | 2.00 |
| PF04024 | PspC | 2.00 |
| PF06094 | GGACT | 1.00 |
| PF13650 | Asp_protease_2 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG5579 | Uncharacterized conserved protein, DUF1810 family | Function unknown [S] | 2.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.00 % |
| All Organisms | root | All Organisms | 1.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300025909|Ga0207705_10125411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1908 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 16.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 11.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.00% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.00% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022903 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L001-104B-6 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0933.00002610 | 2162886012 | Miscanthus Rhizosphere | MKKPAAKPKLPRGRGGKRTDPDERNQATAKDFEREGMGVAPKE |
| C688J18823_105303422 | 3300001686 | Soil | PPRRVFARMKTSKTKPKVPRGRPGKAATKTGATHATSKEFEREGMGVAPKE* |
| Ga0062593_1016095212 | 3300004114 | Soil | MKKPAAKPKLPRGRGGKRTDPDERNQATAKDFEREGMGVAPKE* |
| Ga0063455_1000029951 | 3300004153 | Soil | MKTSKTKPKVPRGRPGKAATKTGATHATSKEFEREGMGVAPKE* |
| Ga0063356_1015475582 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKKPKTKPKVPRDRRASPAQPDELNQATAKDFEREGLGVAPKE* |
| Ga0063356_1030353372 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKKPAAKPKLPRGRAGKQAKPDELNQATAKDFEREGMGVAPKE* |
| Ga0062595_1001527583 | 3300004479 | Soil | MKSEKSKPKIPRGRPGKTANSGKTNRATSSEFEREGMGVAPKE* |
| Ga0062594_1007223293 | 3300005093 | Soil | MRSSAAKPKIPRGKRGAKPASDEANQATAKDFEREGMGVAPKE* |
| Ga0062594_1013337042 | 3300005093 | Soil | MKNIDPKPKKPAAQRGRKADPDELNQATAAEFEREGMGVAPKE* |
| Ga0066671_108639482 | 3300005184 | Soil | MKSTASKPKLPRGRRGKKANSAEINQATAAEFEREGMGVAPKE* |
| Ga0066676_108809251 | 3300005186 | Soil | VRARRVFRSMKSTASKPKLPRGRRGKKANSAEINQATAAEFEREGMGVAPKE* |
| Ga0070658_100135275 | 3300005327 | Corn Rhizosphere | MKSDRSKPKVPRGRGGKAAPKELNQATSKEFEREGMGVAPKE* |
| Ga0070658_103265003 | 3300005327 | Corn Rhizosphere | MAKTSHKSKPKLPRGRRGKPVSDDQELNQATAEDFEEQGMGVAPKE* |
| Ga0070658_103744272 | 3300005327 | Corn Rhizosphere | MKATTDKPKVPRGKRGQKADSGIANKATAKEFEREGMGVAPKE* |
| Ga0070658_104422502 | 3300005327 | Corn Rhizosphere | MTTSASKPKIPRGKRGAKSASGKINQATAKEFEREGMGVAPKE* |
| Ga0070670_1000199443 | 3300005331 | Switchgrass Rhizosphere | MKNIDPKPKKPPARRGRKADPDELNQATAAEFEREGMGVAPKE* |
| Ga0070666_103741642 | 3300005335 | Switchgrass Rhizosphere | MKSTPSKPKIPRGRRGKKVDSDGSNKATAAEFEREGMGVAPKE* |
| Ga0070680_1002994302 | 3300005336 | Corn Rhizosphere | MKSDRTNPKLPRGRGGKKIDAAETNQATSAEFEREGLGIAPKE* |
| Ga0070661_1017422041 | 3300005344 | Corn Rhizosphere | MKAQKTKPKIPRGRLGKKAAPDQSYQATSTEFEREGMGVAPKE |
| Ga0070668_1006637361 | 3300005347 | Switchgrass Rhizosphere | MKNIEPKPKKPAAQRGRKADPDELNQATAAEFEREGMGVAPKE* |
| Ga0070674_1003419375 | 3300005356 | Miscanthus Rhizosphere | RVFGSMKNIDPKPKKPAAQRGRKADPDELNQATAAEFEREGMGVAPKE* |
| Ga0070673_1000282683 | 3300005364 | Switchgrass Rhizosphere | MKSEKSKPKIPRGRPGKTASSGKTNRATSSEFEREGMGVAPKE* |
| Ga0070659_1000207164 | 3300005366 | Corn Rhizosphere | MKNIDPKPKKPAARRGRKADPDELNQATAAEFEREGMGVAPKE* |
| Ga0070659_1012842111 | 3300005366 | Corn Rhizosphere | ELRPAAAGFHLMTTNKSKPKVPRGRRGAGPADGERVRATAKEFEREDMGIAPKE* |
| Ga0066687_105259962 | 3300005454 | Soil | MKTKAKSRAKAKPPQGHPVTKPKELNQATADEFEREGMGIAPKE* |
| Ga0070662_1002332093 | 3300005457 | Corn Rhizosphere | MKAQKTKPKIPRGRLGKKAAPDQSYQATSTEFEREGMGVAPKE* |
| Ga0070739_100719943 | 3300005532 | Surface Soil | MKSPRAKPQLPRGRKGAKPASDERNEATAEEFEREGLGVAPKE* |
| Ga0070686_1019222282 | 3300005544 | Switchgrass Rhizosphere | MRSSAAKPKIPRGKRGAKPASDEANQATAKDFEREGMGVA |
| Ga0068864_1000582742 | 3300005618 | Switchgrass Rhizosphere | MKNIDPKPKKPPARRGKKADPDELNQATAAEFEREGMGVAPKE* |
| Ga0068858_1013198061 | 3300005842 | Switchgrass Rhizosphere | MRSSAAKPKIPRGKRGAKPASDEANQATAKDFEREGMGV |
| Ga0081539_100503831 | 3300005985 | Tabebuia Heterophylla Rhizosphere | LGQVKRPQAKPKLPRGRGGKKKMDSGEMNQATAADFEREGMGIAPKE* |
| Ga0068871_1002903883 | 3300006358 | Miscanthus Rhizosphere | RMKNNEPKTKKPPVQRDRKADPEELNQATSAEFEREGMGVAPKE* |
| Ga0074056_100274553 | 3300006574 | Soil | MKSTPTKPKLPRGRRGQKVDSGKANQATSEEFEREGMGVAPKE* |
| Ga0074054_119656403 | 3300006579 | Soil | MKSTPTKPKLPRGRRGQKVDSGKANQATSEEFEREGMGV |
| Ga0105247_116024871 | 3300009101 | Switchgrass Rhizosphere | MKSEKSKPKIPRGRPGKTANSGKTNRATSSEFEREGM |
| Ga0126313_110084252 | 3300009840 | Serpentine Soil | MKPTPSKPKIPRGKRGKKPASAEINQATADDFEQEGMGVAPKE* |
| Ga0126309_103135022 | 3300010039 | Serpentine Soil | MKPSTSQPKVPRGRRGKKHDSEQLNQATAAEFEREGMGVAPKE* |
| Ga0126309_106980672 | 3300010039 | Serpentine Soil | MKPTSPKPKVPRGRRGKRSSSHEANKATTAEFEQEGMGVAPKE* |
| Ga0126308_100211612 | 3300010040 | Serpentine Soil | MKILKLLQNKAKPPRGRRGKPAKEDELNQATADEFEREGMGIAPKE* |
| Ga0126311_113034072 | 3300010045 | Serpentine Soil | MKATPSKPKIPRGKRGKKPASAEINQATADDFEQEGMGVAPKE* |
| Ga0126320_12736712 | 3300010146 | Soil | MKAEQTKPKVPRGRGGKKTKPRETNQATIAEFERKGLGVAPKE* |
| Ga0126318_110759581 | 3300010152 | Soil | LEDGMKSDRSKPKMPRGRPGKKADSDRTNPATSAEFEREGMGIAPKE* |
| Ga0134126_105935882 | 3300010396 | Terrestrial Soil | MKPSTRPKTRPKLPRGRRGKTPEESERNQATSVEFEREGMGIAPKE* |
| Ga0151489_14024652 | 3300011106 | Soil | MIKMKKLKLPRGLRRKKIDSDEVNQATADEFEREGMGIAPKE* |
| Ga0150985_1038945702 | 3300012212 | Avena Fatua Rhizosphere | PKLPRGRRGQKADSGNANQPTAKEFEREGMGVAPKE* |
| Ga0150984_1020022933 | 3300012469 | Avena Fatua Rhizosphere | PKVPRGRPGKAATKTGATHATSKEFEREGMGVAPKE* |
| Ga0150984_1114405142 | 3300012469 | Avena Fatua Rhizosphere | MKSDRSKPKVPRGRAGKAAPKELNQATSKEFEREGMGVAPKE* |
| Ga0164300_101677113 | 3300012951 | Soil | MAKTSHKSKPKLPRGRRGKPSSDNEELNQATAEDFEEQGMGVAPKE* |
| Ga0164299_106569571 | 3300012958 | Soil | MAKTSHKSKPKLPRGRRGKPASDDEELNQATAEDFEEQGMGVAPKE* |
| Ga0164306_105501682 | 3300012988 | Soil | MAKTSHKSKPKLPRGRRGKPTSDNEELNQATAEDFEEQGMGVAPKE* |
| Ga0164305_101536161 | 3300012989 | Soil | MAKTSSKSKPKLPRGRRGKPVSDDQELNQATAEDFEEQGMGVAPKE* |
| Ga0157370_112979372 | 3300013104 | Corn Rhizosphere | SKPKLPRGRRGKPVSDDQELNQATAEDFEEQGMGVAPKE* |
| Ga0157378_105886301 | 3300013297 | Miscanthus Rhizosphere | MKSTTTKPKLPRGRRGQKVDSGKTNQATAKEFEREGMGVAPKE* |
| Ga0157378_114017212 | 3300013297 | Miscanthus Rhizosphere | MKSTVSKPKIPRGRRGKKADAAPNNKATTAEFEREGLGVAPKE* |
| Ga0163163_124390002 | 3300014325 | Switchgrass Rhizosphere | MKNIDPKPKKPAARRGKKADPDELNQATAAEFEREGMGVAPKE* |
| Ga0182000_102380302 | 3300014487 | Soil | MKKPAAKPKLPRGRGGKRAGPDQLNQATAKEFEREGMGVAPKE* |
| Ga0182001_107063582 | 3300014488 | Soil | MTTSRTPERKAKVPRGRRAKKGRDDELNQATTQEFDREGMGVAAKE* |
| Ga0132257_1017810871 | 3300015373 | Arabidopsis Rhizosphere | MKTNTPKTKKPPVPRDRRADPDELNQATSTEFEREGMGVAPKE* |
| Ga0134112_104992732 | 3300017656 | Grasslands Soil | MKSTASKPKLPRGRRGKKANSAEINQATAAEFEREGMGVAPKE |
| Ga0190273_111148382 | 3300018920 | Soil | MTKNKQSQPKPKQPRGRRTGHPTDNELNQATADEFEREGMGVAPKE |
| Ga0222622_100854031 | 3300022756 | Groundwater Sediment | KLPRGRGGKRTDPDERNQATAKDFEREGMGVAPKE |
| Ga0247774_10913192 | 3300022903 | Plant Litter | PKLPRGRGGKRTDPDERNQATAKDFEREGMGVAPKE |
| Ga0207656_100268682 | 3300025321 | Corn Rhizosphere | MKSEKSKPKIPRGRPGKTANSGKTNRATSSEFEREGMGVAPKE |
| Ga0207642_106784811 | 3300025899 | Miscanthus Rhizosphere | MKNIDPKPKKPAAQRGRKADPDELNQATAAEFEREGMGVAPKE |
| Ga0207680_104928803 | 3300025903 | Switchgrass Rhizosphere | MRSSAAKPKIPRGKRGAKPASDEANQATAKDFEREGMGVAPKE |
| Ga0207680_110296962 | 3300025903 | Switchgrass Rhizosphere | MKSTPSKPKIPRGRRGKKVDSDGSNKATAAEFEREGMGVAPKE |
| Ga0207647_100094745 | 3300025904 | Corn Rhizosphere | MKSDRTKPKLPRGRGGKKTDSDAANKATTAEFEREGLGVAPKE |
| Ga0207645_109361472 | 3300025907 | Miscanthus Rhizosphere | MKSTTTKPKLPRGRRGQKVDSGKTNQATAKEFEREGMGVAPKE |
| Ga0207705_100348123 | 3300025909 | Corn Rhizosphere | MKSTPTKPKLPRGRRGQKVDSGKANQATSEEFEREGMGVAPKE |
| Ga0207705_101254113 | 3300025909 | Corn Rhizosphere | MKSDRSKPKVPRGRGGKAAPKELNQATSKEFEREGMGVAPKE |
| Ga0207705_101615123 | 3300025909 | Corn Rhizosphere | MKSDRTNPKLPRGRGGKKIDAAETNQATSAEFEREGLGIAPKE |
| Ga0207705_105730662 | 3300025909 | Corn Rhizosphere | MKATTDKPKVPRGKRGQKADSGIANKATAKEFEREGMGVAPKE |
| Ga0207705_105818102 | 3300025909 | Corn Rhizosphere | MAKTSHKSKPKLPRGRRGKPVSDDQELNQATAEDFEEQGMGVAPKE |
| Ga0207657_102364804 | 3300025919 | Corn Rhizosphere | SSRMTTSASKPKIPRGKRGAKSASGKINQATAKEFEREGMGVAPKE |
| Ga0207681_108981292 | 3300025923 | Switchgrass Rhizosphere | MRSSAAKPKIPHGKRGAKPASDEANQATAKDFEREGMGVAPKE |
| Ga0207650_100113755 | 3300025925 | Switchgrass Rhizosphere | MKNIDPKPKKPPARRGRKADPDELNQATAAEFEREGMGVAPKE |
| Ga0207664_112149341 | 3300025929 | Agricultural Soil | MKSQTTSKRSKPKLPRGRRGGVAAEKMNQATSKEFEREGMGIAPK |
| Ga0207690_100339433 | 3300025932 | Corn Rhizosphere | MKNIDPKPKKPAARRGRKADPDELNQATAAEFEREGMGVAPKE |
| Ga0207706_105330581 | 3300025933 | Corn Rhizosphere | MKAQKTKPKIPRGRLGKKAAPDQSYQATSTEFEREGM |
| Ga0207651_100732373 | 3300025960 | Switchgrass Rhizosphere | MKSEKSKPKIPRGRPGKTASSGKTNRATSSEFEREGMGVAPKE |
| Ga0207668_106064902 | 3300025972 | Switchgrass Rhizosphere | MKNIEPKPKKPAAQRGRKADPDELNQATAAEFEREGMGVAPKE |
| Ga0207640_109534742 | 3300025981 | Corn Rhizosphere | MKSSDPKAKPPPARRPKKGDPDELNQATTKEFEREGLGVAPKE |
| Ga0207702_110652531 | 3300026078 | Corn Rhizosphere | KPKIPRGRPGKTASSGKTNRATSSEFEREGMGVAPKE |
| Ga0207676_100443882 | 3300026095 | Switchgrass Rhizosphere | MKNIDPKPKKPPARRGKKADPDELNQATAAEFEREGMGVAPKE |
| Ga0207674_106907142 | 3300026116 | Corn Rhizosphere | MKNIDPKPKKPAARRGKKADPDELNQATAAEFEREGMGVAPKE |
| Ga0209474_106341012 | 3300026550 | Soil | MKTKAKSRAKAKPPQGPPVTKPKELNQATADEFEREGMGIAPKE |
| Ga0268266_105648882 | 3300028379 | Switchgrass Rhizosphere | MTTSASKPKIPRGKRGAKSASGKINQATAKEFEREGMGVAPKE |
| (restricted) Ga0255312_11288662 | 3300031248 | Sandy Soil | MKRPQPKRPKPKEPRGRPGLKAGKDVNRATAAEFEREGMGVAPKE |
| Ga0307405_100362893 | 3300031731 | Rhizosphere | MKAAPFKPKVPRGRRGKKPASAEVNQATTEEFEREGLGVAPKE |
| Ga0307406_103153402 | 3300031901 | Rhizosphere | MKILKLFQKAKPPRGRRGKPAKEDELNQATADEFEREGMGIAPKE |
| Ga0307407_104008831 | 3300031903 | Rhizosphere | MKAAPSKPKVPRGRRGKKPASAEVNQATTEEFEREGLGVAPKE |
| Ga0307412_105464733 | 3300031911 | Rhizosphere | MTGTSTRSTKPKLPRGRRGAKPKDENKNQATVEEFDREGLGVAPKE |
| Ga0308175_1000208075 | 3300031938 | Soil | MAKTSSKSKPKLPRGRRGKPVSDDEELNQATAEDFEEQGMGVAPKE |
| Ga0308175_1000541317 | 3300031938 | Soil | MKSTASKPKVPRGRRGKKVNSAEINQATAAEFEREGLGVAPKE |
| Ga0308175_1003167933 | 3300031938 | Soil | MAKTSSKSKPKLPRGRGGKPVSDDEELNQATAEDFEEEGMGVAPKE |
| Ga0308175_1011351512 | 3300031938 | Soil | MAKTSSKSKPKLPRGRRGKPTSDNEELNQATAEDFEEQGMGVAPKE |
| Ga0308176_103259813 | 3300031996 | Soil | LAERVFNWMAKTSSKSKPKLPRGRGGKPVSDDEELNQATAEDFEEEGMGVAPKE |
| Ga0307416_1009528271 | 3300032002 | Rhizosphere | TRSTKPKLPRGRRGAKPQDENKNQATVDEFDREGLGVAPKE |
| Ga0326721_110475722 | 3300032080 | Soil | MKSTTDKPKVPRGKRGQKAGSATGNKATAKEFEREGMGVAPKE |
| Ga0307415_1000270573 | 3300032126 | Rhizosphere | MKAAPSKPKVPRGRRGKKPAPAEVNQATTEEFERDGLGVAPKE |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |