| Basic Information | |
|---|---|
| Family ID | F105272 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 38 residues |
| Representative Sequence | GLVVSQLITLYLTPVVYTYMAGLFKTRKIRGTVAKPATA |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.00 % |
| % of genes from short scaffolds (< 2000 bps) | 96.00 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.82% β-sheet: 0.00% Coil/Unstructured: 64.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00873 | ACR_tran | 78.00 |
| PF07883 | Cupin_2 | 2.00 |
| PF00754 | F5_F8_type_C | 1.00 |
| PF01161 | PBP | 1.00 |
| PF07992 | Pyr_redox_2 | 1.00 |
| PF01266 | DAO | 1.00 |
| PF05698 | Trigger_C | 1.00 |
| PF01979 | Amidohydro_1 | 1.00 |
| PF13667 | ThiC-associated | 1.00 |
| PF01370 | Epimerase | 1.00 |
| PF07228 | SpoIIE | 1.00 |
| PF11790 | Glyco_hydro_cc | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.00 % |
| Unclassified | root | N/A | 9.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908032|Perma_A_C_ConsensusfromContig36850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 959 | Open in IMG/M |
| 3300001686|C688J18823_10145739 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300005180|Ga0066685_10149317 | All Organisms → cellular organisms → Bacteria | 1589 | Open in IMG/M |
| 3300005364|Ga0070673_102122898 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005542|Ga0070732_10881274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300005543|Ga0070672_101166323 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300005575|Ga0066702_10654487 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005616|Ga0068852_102127029 | Not Available | 583 | Open in IMG/M |
| 3300005719|Ga0068861_100107729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2228 | Open in IMG/M |
| 3300005764|Ga0066903_100869327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1626 | Open in IMG/M |
| 3300005764|Ga0066903_102557898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300005764|Ga0066903_105416516 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005764|Ga0066903_107830194 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005764|Ga0066903_108547948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 522 | Open in IMG/M |
| 3300005843|Ga0068860_100529118 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300005843|Ga0068860_101003260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 853 | Open in IMG/M |
| 3300005844|Ga0068862_100347827 | All Organisms → cellular organisms → Bacteria | 1375 | Open in IMG/M |
| 3300006031|Ga0066651_10160646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1181 | Open in IMG/M |
| 3300006358|Ga0068871_101397334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300006854|Ga0075425_101317329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 818 | Open in IMG/M |
| 3300006871|Ga0075434_101565101 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006880|Ga0075429_100455527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300006953|Ga0074063_13718705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 527 | Open in IMG/M |
| 3300006969|Ga0075419_11399642 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009011|Ga0105251_10147557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300009137|Ga0066709_100193002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Dongia → unclassified Dongia → Dongia sp. URHE0060 | 2665 | Open in IMG/M |
| 3300009137|Ga0066709_102703313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300009162|Ga0075423_10417806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1408 | Open in IMG/M |
| 3300009176|Ga0105242_10819166 | Not Available | 923 | Open in IMG/M |
| 3300009177|Ga0105248_11447757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300009551|Ga0105238_12896815 | Not Available | 516 | Open in IMG/M |
| 3300009661|Ga0105858_1080220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300010329|Ga0134111_10137294 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300010358|Ga0126370_12476214 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010359|Ga0126376_11291659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300010364|Ga0134066_10161403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300010376|Ga0126381_100427409 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300010376|Ga0126381_100567932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1610 | Open in IMG/M |
| 3300010379|Ga0136449_102790856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300010398|Ga0126383_12878376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300012096|Ga0137389_10834412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300012189|Ga0137388_10671496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300012199|Ga0137383_11052069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300012201|Ga0137365_10079140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2478 | Open in IMG/M |
| 3300012357|Ga0137384_11172022 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012948|Ga0126375_11778174 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012951|Ga0164300_10743784 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012971|Ga0126369_12049686 | Not Available | 660 | Open in IMG/M |
| 3300012971|Ga0126369_12332335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300012989|Ga0164305_10745127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300013297|Ga0157378_10742238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300013307|Ga0157372_11775104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300014968|Ga0157379_11038549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300014968|Ga0157379_12356884 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300014968|Ga0157379_12399951 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300015373|Ga0132257_100828872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1156 | Open in IMG/M |
| 3300017659|Ga0134083_10307499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300017947|Ga0187785_10080801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1270 | Open in IMG/M |
| 3300018000|Ga0184604_10280142 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300018029|Ga0187787_10220971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300018433|Ga0066667_10410459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
| 3300019356|Ga0173481_10271109 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300021363|Ga0193699_10254984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300021479|Ga0210410_10647914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300022532|Ga0242655_10281974 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300022756|Ga0222622_11303911 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300025321|Ga0207656_10132252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1170 | Open in IMG/M |
| 3300025899|Ga0207642_10422098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300025908|Ga0207643_10752375 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300025920|Ga0207649_10393821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
| 3300025921|Ga0207652_11526340 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300025926|Ga0207659_10655255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300025927|Ga0207687_11098933 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300025927|Ga0207687_11152219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300025933|Ga0207706_10952058 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300025940|Ga0207691_10243040 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300025941|Ga0207711_11286764 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300025942|Ga0207689_11667541 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300026041|Ga0207639_10966610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300026041|Ga0207639_12251139 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300026095|Ga0207676_11153603 | Not Available | 767 | Open in IMG/M |
| 3300026142|Ga0207698_10762092 | Not Available | 967 | Open in IMG/M |
| 3300027842|Ga0209580_10529934 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300028784|Ga0307282_10548291 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300028875|Ga0307289_10425940 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300029636|Ga0222749_10368801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300031232|Ga0302323_101547055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300031748|Ga0318492_10218855 | Not Available | 978 | Open in IMG/M |
| 3300031894|Ga0318522_10279529 | Not Available | 633 | Open in IMG/M |
| 3300031902|Ga0302322_103335229 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031908|Ga0310900_11145950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300031947|Ga0310909_10723710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300031996|Ga0308176_11341973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300032001|Ga0306922_11430138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300032051|Ga0318532_10228286 | Not Available | 661 | Open in IMG/M |
| 3300032160|Ga0311301_10242522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2990 | Open in IMG/M |
| 3300032160|Ga0311301_12414935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300032829|Ga0335070_10535299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
| 3300033412|Ga0310810_10572519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1095 | Open in IMG/M |
| 3300034268|Ga0372943_0441899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 843 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908032 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_all | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Perma_A_C_03675920 | 2124908032 | Soil | VGGLVVSQIITLYLTPVVYTYMAQVLKTRKIPNVATRPATA |
| C688J18823_101457391 | 3300001686 | Soil | SQLITLYLTPVVYTYMAGLFKTRRIRATVANPATA* |
| Ga0066685_101493172 | 3300005180 | Soil | VGGLVVSQLITLYLTPVVYTYMATLFKTRKIPDTSPVMA* |
| Ga0070673_1021228981 | 3300005364 | Switchgrass Rhizosphere | GGLVVSQLITLYLTPVVYTFFGGLVKTRRIEGPAAASTPATA* |
| Ga0070732_108812742 | 3300005542 | Surface Soil | VSQLITLYLTPVVYTYMAAIFSTSRRVGTVGAVSIAG* |
| Ga0070672_1011663232 | 3300005543 | Miscanthus Rhizosphere | SQLITLYLTPVVYTFFGSLVKTRQIVGAAPASKPATA* |
| Ga0066702_106544872 | 3300005575 | Soil | QLITLYLTPVVYTYMAGMFKTRTIRGTVPKPVTV* |
| Ga0068852_1021270292 | 3300005616 | Corn Rhizosphere | QLITLYLTPVVYTYMAGLVKTRRIPMSVAAKPRPA* |
| Ga0068861_1001077295 | 3300005719 | Switchgrass Rhizosphere | GLVVSQFITLYLTPVIYTYMAALVKTREIPAGATTKPATA* |
| Ga0066903_1008693272 | 3300005764 | Tropical Forest Soil | ITLYLTPVVYTYMATLVKTRKIEKVPGAAPSLAN* |
| Ga0066903_1025578982 | 3300005764 | Tropical Forest Soil | GLVVSQLITLYLTPVVYTYLASWVKTRQIPVSAVSKPATA* |
| Ga0066903_1054165162 | 3300005764 | Tropical Forest Soil | AVVGGLMVSQLITLYLTPVIYTYMAGMFKTRKIPQVAASQA* |
| Ga0066903_1078301941 | 3300005764 | Tropical Forest Soil | QFITLYLTPVVYTYMAQLIATRRIPSTLSARPASA* |
| Ga0066903_1085479482 | 3300005764 | Tropical Forest Soil | SQLITLYLTPVVYTYMAGLFKTRKIRGTVTKPVTA* |
| Ga0068860_1005291183 | 3300005843 | Switchgrass Rhizosphere | VVGGLMVSQLVTLYLTPVVYTYMAALVKTRPIPAGIVTRPATA* |
| Ga0068860_1010032601 | 3300005843 | Switchgrass Rhizosphere | VSQLITLYLTPVVYTYLAGMFKTRKIAMTKPVTA* |
| Ga0068862_1003478272 | 3300005844 | Switchgrass Rhizosphere | AVVGGLIVSQLITLYLTPVVYTYMAGMFKTSKIHGAVAAKPATA* |
| Ga0066651_101606461 | 3300006031 | Soil | QLITLYLTPVVYTYMAGMFKTRKIPVTRPVTAQTIG* |
| Ga0068871_1013973342 | 3300006358 | Miscanthus Rhizosphere | ITLYLTPVVYTYMATLVKTRRIPATASTEPLTAQG* |
| Ga0075425_1013173291 | 3300006854 | Populus Rhizosphere | SQLITLYLTPVVYTYMATMFKTRKIPQTAAKPATA* |
| Ga0075434_1015651011 | 3300006871 | Populus Rhizosphere | GGLLVSQLITLYLTPVVYTYMATLFKTRKIREAVPA* |
| Ga0075429_1004555272 | 3300006880 | Populus Rhizosphere | LITLYLTPVVYTYLAGLVKTRRIAAVSTATPATAHS* |
| Ga0074063_137187051 | 3300006953 | Soil | SQLITLYLTPVVYTYLASIFKTRKIPVTATSPATA* |
| Ga0075419_113996422 | 3300006969 | Populus Rhizosphere | GLLVSQLITLYLTPVVYTYLGGLVKTRRIAPSTASPDPATA* |
| Ga0105251_101475572 | 3300009011 | Switchgrass Rhizosphere | VVSQLITLYLTPVVYTYMAGMFKTRKIREAVAKPVTA* |
| Ga0066709_1001930025 | 3300009137 | Grasslands Soil | LLVSQLITLYLTPVIYTCLASAVKTRRIESPRPEPVTV* |
| Ga0066709_1027033132 | 3300009137 | Grasslands Soil | GGLLVSQLITLYLTPVVYTYMASSFKTRKIPVTAPSRA* |
| Ga0075423_104178062 | 3300009162 | Populus Rhizosphere | VSQLITLYLTPVIYTYMATMFKTSTIPKTVMANG* |
| Ga0105242_108191662 | 3300009176 | Miscanthus Rhizosphere | LITLYLTPVVYTYLASIFKTRKIPVTATTNPATA* |
| Ga0105248_114477572 | 3300009177 | Switchgrass Rhizosphere | GLLVSQLITLYLTPVVYTYMAAMFKTSKIPVTVATKPATA* |
| Ga0105238_128968152 | 3300009551 | Corn Rhizosphere | QLITLYLTPVVYTYMAGMFKTSKIHGAVAAKPATA* |
| Ga0105858_10802201 | 3300009661 | Permafrost Soil | VSQLITLYLTPVIYTYMAALVKTRKIPATVVIKPATA* |
| Ga0134111_101372941 | 3300010329 | Grasslands Soil | ITLYLTPVVYTYMAGMFKTRKIPVTRPVTAQTIG* |
| Ga0126370_124762141 | 3300010358 | Tropical Forest Soil | VVGGLMVSQLITLYLTPVVYTYLATIFKTRQIPETVATTS* |
| Ga0126376_112916592 | 3300010359 | Tropical Forest Soil | VITLYLTPVVYTFMATWVKTRKIPAVAGEPIVSEQ* |
| Ga0134066_101614032 | 3300010364 | Grasslands Soil | VVGGLVVSQLITLYLTPVVYTYMATLFKTRKIPVTKPVTA* |
| Ga0126381_1004274093 | 3300010376 | Tropical Forest Soil | GGLIVSQLITLYLTPVVYTYMASLVKTRRISAGLESKPATA* |
| Ga0126381_1005679322 | 3300010376 | Tropical Forest Soil | GGLMVSQLITLYLTPVVYTYLATIFKTRQIPETAATTS* |
| Ga0136449_1027908561 | 3300010379 | Peatlands Soil | VSQFITLYLTPVVYTYLATAVRTRRIAEPIAANPATA* |
| Ga0126383_128783762 | 3300010398 | Tropical Forest Soil | VVGGLVVSQLITLYLTPVVYTYMATLFKTRKIPQTATKPVTA* |
| Ga0137389_108344121 | 3300012096 | Vadose Zone Soil | VSQLITLYLTPVVYTYMAGMFKTRRIREVVTKPATA* |
| Ga0137388_106714962 | 3300012189 | Vadose Zone Soil | LVVSQLITLYLTPVVYTYMAGMFKTRKIPVTKTVTA* |
| Ga0137383_110520692 | 3300012199 | Vadose Zone Soil | AVVGGLLVSQLITLYLTPVVYTYMAMMFKTRRIPDTSPITA* |
| Ga0137365_100791402 | 3300012201 | Vadose Zone Soil | GLVVSQLITLYLTPVVYTYMAAMFKTRRIPQTATA* |
| Ga0137384_111720221 | 3300012357 | Vadose Zone Soil | GGLMISQLITLYLTPVVYTYMAQLFKTRKIPDVSSNPATA* |
| Ga0126375_117781743 | 3300012948 | Tropical Forest Soil | SQLITLYLTPVVYTYLAAIFKTRKVAPSIATKPVTA* |
| Ga0164300_107437841 | 3300012951 | Soil | LVSQLITLYLTPVVYVYLARLVKTRKISDVAVPRPATA* |
| Ga0126369_120496862 | 3300012971 | Tropical Forest Soil | SQLITLYLTPVVYTYFAALVRTRPIAMTLTESRSPAH* |
| Ga0126369_123323352 | 3300012971 | Tropical Forest Soil | VVGGLVVSQLITLYLTPVIYTYMAALVKTRRVPA* |
| Ga0164305_107451272 | 3300012989 | Soil | LVVSQLITLYLTPVVYTYMAAMFKTRRIPQTVTAS* |
| Ga0157378_107422381 | 3300013297 | Miscanthus Rhizosphere | QLITLYLTPVVYTYMAGLFKTRKIRGTVADPATA* |
| Ga0157372_117751041 | 3300013307 | Corn Rhizosphere | LLVSQLITLYLTPVVYVYLARMVKTRKISDVVVPRPATA* |
| Ga0157379_110385492 | 3300014968 | Switchgrass Rhizosphere | GGLVVSQLITLYLTPVVYTFFGSLVKTRQIVSAAPASKPATA* |
| Ga0157379_123568842 | 3300014968 | Switchgrass Rhizosphere | VSQLITLYLTPVVYTYLARLVKTRKISDVAVPRPATA* |
| Ga0157379_123999512 | 3300014968 | Switchgrass Rhizosphere | IGGLMISQLITLYLTPVVYTYLASIFKTRKIPATATTTPATA* |
| Ga0132257_1008288722 | 3300015373 | Arabidopsis Rhizosphere | SQLITLYLTPVVYTYLGGLVKTRRIAPTTASPNPATA* |
| Ga0134083_103074991 | 3300017659 | Grasslands Soil | LVSQLITLYLTPVVYTYMAAIVKTRRIPATRPATA |
| Ga0187785_100808012 | 3300017947 | Tropical Peatland | IVSQLLTLYLTPVVYTYMAKVFKTSRIAATEPVTA |
| Ga0184604_102801422 | 3300018000 | Groundwater Sediment | GGLVVSQLITLYLTPVVYTYMAGLFKTSKIRGAVAKPVTA |
| Ga0187787_102209711 | 3300018029 | Tropical Peatland | SQLITLYLTTVVYTYMAQIMRTRKIPATVSTPAHA |
| Ga0066667_104104592 | 3300018433 | Grasslands Soil | GGLLVSQLITLYLTPVIYTYMASIFKTRKILAIETKPAVG |
| Ga0173481_102711092 | 3300019356 | Soil | ITLYLTPVIYTYLGGIERRWKTRRIAPRGTASTNPATA |
| Ga0193699_102549842 | 3300021363 | Soil | ITLYLTPVVYTYMATWVKTRKIPATSTAPIAATPTTA |
| Ga0210410_106479141 | 3300021479 | Soil | LITLYLTPVLYIYLASIVKTRHFTATSQAGTVPAVS |
| Ga0242655_102819741 | 3300022532 | Soil | GGLMVSQLITLYLTPVIYTYLASIFKTRKIPSTVTARPATA |
| Ga0222622_113039112 | 3300022756 | Groundwater Sediment | GLIVSQLITLYLTPVVYTYLAGLFKTSKIRGAVAKPVTA |
| Ga0207656_101322521 | 3300025321 | Corn Rhizosphere | LISQLITLYLTPVVYTYLGGLVKTRRIAPTTASPNPATA |
| Ga0207642_104220982 | 3300025899 | Miscanthus Rhizosphere | GGLLVSQLITLYLTPVVYTYLGGLVRTRKIAPGAASPDPSPA |
| Ga0207643_107523751 | 3300025908 | Miscanthus Rhizosphere | VGGLMVSQLITLYLTPVVYTYMASMFKTSKIAPTVAPKPATA |
| Ga0207649_103938211 | 3300025920 | Corn Rhizosphere | SQLITLYLTPVVYTYLGGLVRTRKIAPGAASPDPSPA |
| Ga0207652_115263402 | 3300025921 | Corn Rhizosphere | LVVSQLITLYLTPVVYTYLAGLVKTRRIPALTHPAPAT |
| Ga0207659_106552551 | 3300025926 | Miscanthus Rhizosphere | VGGLVVSQLITLYLTPVVYTYMAAMFKTRRIPQTATA |
| Ga0207687_110989331 | 3300025927 | Miscanthus Rhizosphere | GGLVVSQLITLYLTPVVYTYMAGLFKTRGIRGAVAKPATA |
| Ga0207687_111522191 | 3300025927 | Miscanthus Rhizosphere | GGLVVSQLITLYLTPVVYTYMAGLFKTRKIRGTVADPATA |
| Ga0207706_109520581 | 3300025933 | Corn Rhizosphere | GGLIVSQLITLYLTPVVYTYMAGLFKTSKIRGTVVKPVTA |
| Ga0207691_102430403 | 3300025940 | Miscanthus Rhizosphere | MRANPIGAPGGGLMVSQLITLYLTPVVYTYMAAIMKTRPIAAPVSSDPATA |
| Ga0207711_112867641 | 3300025941 | Switchgrass Rhizosphere | GGLMISQLITLYLTPVVYTYLASIFKTRKIPVTATTNPATA |
| Ga0207689_116675411 | 3300025942 | Miscanthus Rhizosphere | IGGLMISQLITLYLTPVVYTYLASIFKTRKIPATATTTPATA |
| Ga0207639_109666102 | 3300026041 | Corn Rhizosphere | LIVSQLITLYLTPVVYTYMATMFKTRRIPQTAVAAAARS |
| Ga0207639_122511392 | 3300026041 | Corn Rhizosphere | GGLIGSQRITLYLTPVVYTYMATMFKTRKIPQTAAKPATA |
| Ga0207676_111536032 | 3300026095 | Switchgrass Rhizosphere | GGLLVSQLITLYLTPVIYSYFGQLVKTRRIAPASSPRPATA |
| Ga0207698_107620922 | 3300026142 | Corn Rhizosphere | LVSQLITLYLTPVVYTYLATLVRTRHIPATSAHPAPAQS |
| Ga0209580_105299341 | 3300027842 | Surface Soil | VSQLITLYLTPVVYTYMAGLFKTRKIPQIAVVSEA |
| Ga0307282_105482912 | 3300028784 | Soil | GGLIVSQLITLYLTPVVYTYMAGLFKTSRIRGAVAAKPVSA |
| Ga0307289_104259401 | 3300028875 | Soil | VSQLITLYLTPVIYTYMAGLFKTSKIRGAVAAKPATA |
| Ga0222749_103688012 | 3300029636 | Soil | VGGLVVSQVITLYLTPVVYTYMAALLKTRKIPPTAIAKPATA |
| Ga0302323_1015470551 | 3300031232 | Fen | VVSQLITLYLTPVVYTYMAALVKTRKLATSASPRPATT |
| Ga0318492_102188552 | 3300031748 | Soil | VVSQLITLYLTPVVYTYMATWVKTRRITTSAATKPATA |
| Ga0318522_102795292 | 3300031894 | Soil | QLITLYLTPVVYTYMATWVKTRRITTSAATKPATA |
| Ga0302322_1033352291 | 3300031902 | Fen | LYLTPVVYTFMATWVKTRKIAVISATPATVTSAEA |
| Ga0310900_111459501 | 3300031908 | Soil | GGLLVSQLITLYLTPVVYTYLAQMFKTRRIPEIKPATA |
| Ga0310909_107237102 | 3300031947 | Soil | GLVVSQLITLYLTPVVYTYMAGLFKTRKIRGTVAKPATA |
| Ga0308176_113419732 | 3300031996 | Soil | VIGGLMISQLITLYLTPVVYTYLASIFKTRKIPSTATRPATA |
| Ga0306922_114301381 | 3300032001 | Soil | GLVVSQLITLYLTPVVYTYLATFVKTSRIPGELATSPQHP |
| Ga0318532_102282862 | 3300032051 | Soil | SQLITLYLTPVVYTYMATWVKTRRITTSAATKPATA |
| Ga0311301_102425226 | 3300032160 | Peatlands Soil | LVVSQLITLYLTPVVYTYLARVVKTRKLLTPASSAT |
| Ga0311301_124149351 | 3300032160 | Peatlands Soil | VSQFITLYLTPVVYTYLATAVRTRRIAEPIAANPATA |
| Ga0335070_105352991 | 3300032829 | Soil | VGGLIVSQVITLYLNPVVYTYMATWVKTSRIRTAGAVATTE |
| Ga0310810_105725192 | 3300033412 | Soil | GLVVSQVITLYLTPVVYTYMATWIKTRKIPVTAATTAPPATATPTTA |
| Ga0372943_0441899_4_117 | 3300034268 | Soil | VSQLITLYLTPVVYTYMAGLFKTRRIRGAVATNPATA |
| ⦗Top⦘ |