 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F105271 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | DELRAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSSLG |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (12.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01230 | HIT | 65.00 |
| PF06772 | LtrA | 13.00 |
| PF13673 | Acetyltransf_10 | 3.00 |
| PF00072 | Response_reg | 1.00 |
| PF00583 | Acetyltransf_1 | 1.00 |
| PF00625 | Guanylate_kin | 1.00 |
| PF01850 | PIN | 1.00 |
| PF01510 | Amidase_2 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 13.00 |
| COG0194 | Guanylate kinase | Nucleotide transport and metabolism [F] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 8.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 6.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.00% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.00% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.00% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.00% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2067725002 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300022908 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300023264 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICC_00697850 | 2067725002 | Soil | MTRDELKAFDDAVLDDGTATGWSLYDFQTTTPAGWAAMARLGESLG |
| JGI11643J12802_101299301 | 3300000890 | Soil | FDDAVLDDGTATGWSLYDFQTTTPAAWAAMARLGDSLG* |
| JGI24739J22299_100816521 | 3300001989 | Corn Rhizosphere | AFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSLLG* |
| Ga0062590_1021761461 | 3300004157 | Soil | ANRMTKDELRAFDDAVLDDGTATGWSLYDFQTTTPAGWAAMARLGESLG* |
| Ga0062595_1019671931 | 3300004479 | Soil | AFDDAVLDDGTATGWSLYDFQTTTPVGWAAMARLGQSLG* |
| Ga0062591_1002519123 | 3300004643 | Soil | ELKAFDDAVLDDGTATGWSLYDFQTTPPAGWAAMARLGESLG* |
| Ga0065717_10146212 | 3300005276 | Arabidopsis Rhizosphere | ANRMTKEELKAFDDAVLDDGTATGWSLYDFQTTTPAGWAAMARLGESLG* |
| Ga0070676_109255382 | 3300005328 | Miscanthus Rhizosphere | VANRMTADELRAFDDAVLDDGTATGWSLYDLQTTTPVGWAAMARLTSSLG* |
| Ga0070676_110728591 | 3300005328 | Miscanthus Rhizosphere | RMTADELRAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLASSLG* |
| Ga0070683_1021971851 | 3300005329 | Corn Rhizosphere | NRMNAEELKAFVDAVNDEGSITGWSFYDFQTTDPRGWAALKNVES* |
| Ga0070670_1017189232 | 3300005331 | Switchgrass Rhizosphere | AAGGVTNRMTADELRAFDDAVLDDGTVTGWSLYDLQTATPAGWAAMARLSASLG* |
| Ga0066388_1081651852 | 3300005332 | Tropical Forest Soil | MTAEELKAFVDAVTDEGSVTGWSLYDFQTTGPKGWAALATLGTG* |
| Ga0070691_102560161 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VANRMTADELRAFDEAVLDDGTATGWSLYDLQTTTPVGWAAMARLSSSLG* |
| Ga0070687_1010872961 | 3300005343 | Switchgrass Rhizosphere | MTADELRAFDDAVLDDGTVTGWSLYDLQTATPAGWAAMARLSASLG* |
| Ga0070692_102811251 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | AGGVANRMTADELRAFDDAVLDDGTATGWSLYDLQTTTPVGWAAMARLTSSLG* |
| Ga0070673_1007944562 | 3300005364 | Switchgrass Rhizosphere | ELKAFADAVTDEGSVTGWSLYDFQTTGPKGWAALKPLGTAG* |
| Ga0070659_1002349071 | 3300005366 | Corn Rhizosphere | AAGGVANRMTADELRAFDDAVLDDGTATGWSLYDLQTTTPVGWAAMARLSSSLG* |
| Ga0070701_108908301 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | ELRAFDDAVLDDGTATGWSLYDLQTTTPVGWAAMARLSSSLG* |
| Ga0070678_1004686813 | 3300005456 | Miscanthus Rhizosphere | ELKAFVDAVTDEGSVTGWSLYDFQTTGPKGWAALAALGTG* |
| Ga0070678_1017614991 | 3300005456 | Miscanthus Rhizosphere | DELRAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLASSLG* |
| Ga0070681_113966722 | 3300005458 | Corn Rhizosphere | DELRAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSVLG* |
| Ga0070679_1009012431 | 3300005530 | Corn Rhizosphere | VANRMTADELRAFDDAVLDDGTATGWSLYDLQTTTPVGWAAMARLSSSLG* |
| Ga0068854_1014036751 | 3300005578 | Corn Rhizosphere | HAAGGVPSRMTLDELKAFVDAVTDDGTVTGWSLYDFGTTRPAAWAALAPLGTAPTS* |
| Ga0070702_1006255763 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | RAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLASSLG* |
| Ga0068851_102412671 | 3300005834 | Corn Rhizosphere | DAVLDDGTVTGWSLYDLQTSTPAAWAAMARLSEALG* |
| Ga0068862_1023488491 | 3300005844 | Switchgrass Rhizosphere | VLDDGTASGWSLYDFQTTTPAGWAAMSRLGQSLG* |
| Ga0075286_10526062 | 3300005886 | Rice Paddy Soil | FDDAVLDDGTVTGWSLYDYQTMTPAAWAAMARLGASLG* |
| Ga0075290_10253121 | 3300005889 | Rice Paddy Soil | VANRMTKEELKAFDDAVLDDGTASGWSLYDFQTTTPAGWAAMARLSESLG* |
| Ga0068871_1014602062 | 3300006358 | Miscanthus Rhizosphere | GGVANRMTADELRAFDDAVLDDGTATGWSLYDLQTTTPVGWAAMARLSSSLG* |
| Ga0074047_118798992 | 3300006576 | Soil | RMTADELRAFDDAVLDDGTVTGWSLYDLQTATPAGWAAMARLSASLG* |
| Ga0075429_1000410556 | 3300006880 | Populus Rhizosphere | AFDDAVLDDGTASGWSLYDFQTTTPAGWAAMARLGESLG* |
| Ga0079219_107520401 | 3300006954 | Agricultural Soil | PSRMTLDELKAFVDAVTDDGTVTGWSLYDFGTTRPAAWAALAPLGTAPTS* |
| Ga0105244_103494752 | 3300009036 | Miscanthus Rhizosphere | VDVVDDAVLDDGTATGWSLYDLQTTTPVGWAAMARLSSSLG* |
| Ga0105240_122945742 | 3300009093 | Corn Rhizosphere | VANRMSSEELKAFTDAVLDDGTVTGWSLYDLQTSTPAAWAAMARLSEALG* |
| Ga0105247_108530142 | 3300009101 | Switchgrass Rhizosphere | AGGVTNRMTADELRAFDDAVLDDGTVTGWSLYDLQTATPAGWAAMARLSASLG* |
| Ga0075423_104728221 | 3300009162 | Populus Rhizosphere | DELRAFDDAVLDDGTASGWSLYDFQTTTPAGWAAMSRLGQSLG* |
| Ga0105100_105577572 | 3300009166 | Freshwater Sediment | VVDDGTVAGWSLYDLQTTTPAGWAAMSRLSRSLG* |
| Ga0113563_124143371 | 3300009167 | Freshwater Wetlands | ELKAFVDAVLDDGTVTGWGLYDFHTTGPKAWAALTPLGTG* |
| Ga0105238_108708941 | 3300009551 | Corn Rhizosphere | EELKAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLGESLG* |
| Ga0105249_105260661 | 3300009553 | Switchgrass Rhizosphere | NRMTKEELKAFDDAVLDDGTATGWSLYDFQTTTPAGWAAMARLGESLG* |
| Ga0105249_124494061 | 3300009553 | Switchgrass Rhizosphere | AFVDAVTDEGSVTGWSLYDFQTTGSRAWAAIAPLGTG* |
| Ga0105249_135665332 | 3300009553 | Switchgrass Rhizosphere | AVTDEGSVTGWSLYDFQTTGPMGWAALKRLETAG* |
| Ga0130016_104230221 | 3300009868 | Wastewater | KAFADAVADDGSVGGWSLYDFMTTTSGGWKALAPLGGTR* |
| Ga0134127_101987881 | 3300010399 | Terrestrial Soil | AVLDDGTATGWSLYDFQTTTPAGWAAMARLGESLG* |
| Ga0134127_136111131 | 3300010399 | Terrestrial Soil | VANRMTAEELRAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSLLG* |
| Ga0105246_121565672 | 3300011119 | Miscanthus Rhizosphere | DAVLDDGTVTGWSLYDLQTTTPAGWAAMARLSASLG* |
| Ga0157346_10300662 | 3300012480 | Arabidopsis Rhizosphere | VRAFLDTVADDGGTIGVSLYDWMTTTPRAWKALAPLGAA* |
| Ga0157314_10268571 | 3300012500 | Arabidopsis Rhizosphere | KAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLGESLG* |
| Ga0157292_102544431 | 3300012900 | Soil | GGVANRMTKEELKAFDDAVLDDGTATGWSLYDFQTTTPAGWAAMARLGESLG* |
| Ga0157283_100308481 | 3300012907 | Soil | FDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSSLG* |
| Ga0157306_100068163 | 3300012912 | Soil | MTKDELKAFDDAVLDDGTATGWSLYDFQTTTPAGWAAMARLGESLG* |
| Ga0164302_100907911 | 3300012961 | Soil | DELRAFDDAVLDDGTATGWSLYDLQTTTPVGWAAMARLSSSLG* |
| Ga0157370_108134651 | 3300013104 | Corn Rhizosphere | ANRMTAEELRAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSLLG* |
| Ga0163162_123371192 | 3300013306 | Switchgrass Rhizosphere | GVPSRMTLDELKAFVDAVTDDGTVTGWSLYDFGTTRPAAWAALAPLGTAPTS* |
| Ga0157375_120545702 | 3300013308 | Miscanthus Rhizosphere | NRMTPDELRAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSSLG* |
| Ga0163163_107791071 | 3300014325 | Switchgrass Rhizosphere | ADRMNAEELKAFVDAVTDEGSVTGWSLYDFQTTRPQAWAALKPLGTS* |
| Ga0157380_106824061 | 3300014326 | Switchgrass Rhizosphere | NRMTADELRAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSSLG* |
| Ga0182008_105320982 | 3300014497 | Rhizosphere | TADELRAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSSLG* |
| Ga0157376_125734282 | 3300014969 | Miscanthus Rhizosphere | ANRMNAEELKAFVDAVTDEGSVTGWSLYDFQTTGPKAWTALKPLGTTG* |
| Ga0132258_101662687 | 3300015371 | Arabidopsis Rhizosphere | EELKAFTDAVLDDGTVTGWSLYDLQTSTPTGWAAMARLSEALG* |
| Ga0132256_1021082662 | 3300015372 | Arabidopsis Rhizosphere | DELRAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSSLG* |
| Ga0136617_105429194 | 3300017789 | Polar Desert Sand | ELKAFSDAVLDDGRIVGWSLYDLQTMTPAAWTAMARLTAARG |
| Ga0190274_126371922 | 3300018476 | Soil | FTDAVLDDGTATGWSLYDLQTTTPAGWAAMARLTASAG |
| Ga0190271_100862905 | 3300018481 | Soil | MDGEELRAFADAVLDDGSASGWCLYDLQTTTPAGWAAMARLTRAAG |
| Ga0247788_10126873 | 3300022901 | Soil | KAFDDAVLDDGTATGWSLYDFQTTTPAGWAAMARLGESLG |
| Ga0247779_11195441 | 3300022908 | Plant Litter | DAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSSLG |
| Ga0247790_100308433 | 3300022915 | Soil | MSSEELKAFTDAVLDDGTVTGWSLYDLQTSTPAAWAAMARLSEALG |
| Ga0247801_10156961 | 3300023064 | Soil | NRMTAEELRAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSLLG |
| Ga0247802_10010011 | 3300023077 | Soil | MSKEELRAFDDAVLDDGTATGWSLYDFQTTTPVGWAAMARLGQSLG |
| Ga0247772_10856001 | 3300023264 | Plant Litter | RAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSLLG |
| Ga0207707_112485712 | 3300025912 | Corn Rhizosphere | DDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSVLG |
| Ga0207660_101328763 | 3300025917 | Corn Rhizosphere | TADELRAFDEAVLDDGTATGWSLYDLQTTTPAGWAAMARLASSLG |
| Ga0207660_106031221 | 3300025917 | Corn Rhizosphere | TADELRAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSLLG |
| Ga0207652_118287861 | 3300025921 | Corn Rhizosphere | ANRMTADELRAFDDAVLDDGTATGWSLYDLQTTTPVGWAAMARLSSSLG |
| Ga0207687_101048075 | 3300025927 | Miscanthus Rhizosphere | DELKAFVDAVTDEGSVTGWSLYDFQTTGPKGWAALAALGTG |
| Ga0207689_114910471 | 3300025942 | Miscanthus Rhizosphere | KDELRAFDDAVLDDGTATGWSLYDFQTTTPAGWAAMARLGESLG |
| Ga0207661_119752692 | 3300025944 | Corn Rhizosphere | RAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSSLG |
| Ga0207667_115899891 | 3300025949 | Corn Rhizosphere | NRMSKEELRAFDDAVLDDGTATGWSLYDFQTTTPVGWAAMARLGQSLG |
| Ga0207712_108248313 | 3300025961 | Switchgrass Rhizosphere | NRMTKEELKAFDDAVLDDGTATGWSLYDFQTTTPAGWAAMARLGESLG |
| Ga0207712_117609732 | 3300025961 | Switchgrass Rhizosphere | GVANRMTKDELRAFDDAVLDDGTASGWSLYDFQTTTPAGWAAMSRLGQSLG |
| Ga0207640_119550892 | 3300025981 | Corn Rhizosphere | SKEELRAFDDAVLDDGTATGWSLYDFQTTTPVGWAAMARLGQSHG |
| Ga0268264_105634363 | 3300028381 | Switchgrass Rhizosphere | AGGVANRMTAEELRAFDDAVLGDGTATGWSLYDLQTTTPAGWAAMARLSSLLG |
| Ga0247828_102014921 | 3300028587 | Soil | RMTKEELKAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLGESLG |
| Ga0247828_106136292 | 3300028587 | Soil | AVLDDGTATGWSLYDLQTTTPAGWAAMARLASSLG |
| Ga0247819_107415661 | 3300028608 | Soil | AAGGVANRMTAEELRAFTDAVLDDGTATGWSLYDLQTMTPAGWAAMTRLTASAG |
| Ga0307283_100645812 | 3300028790 | Soil | AEELKAFVDAVTDEGSVTGWSLYDFQTTRPQAWAALKPLGTS |
| Ga0247825_100495465 | 3300028812 | Soil | RAFTDAVLDDGTATGWSLYDLQTTTPAGWAAMARLTASAG |
| Ga0247825_104879873 | 3300028812 | Soil | AFDDAVLDDGTATGWSLYDLQTTTPVGWAAMARLSSSLG |
| Ga0247827_101925333 | 3300028889 | Soil | RAFTDAVLDDGTATGWSLYDLQTTTPAAWAAMARLTASAG |
| Ga0247826_100836923 | 3300030336 | Soil | MPKDELKAFDDAVLDDGTATGWSLYDFQTTPPAGWAAMARLGESLG |
| Ga0310813_117842762 | 3300031716 | Soil | TKDELKAFDDAVLDDGTATGWSLYDFQTTTPAGWAAMARLGVSLG |
| Ga0307468_1007045491 | 3300031740 | Hardwood Forest Soil | ELKAFTDAVLDDGTATGWSLYDLQTSTAAGWEAMARLTAAAG |
| Ga0310893_103020392 | 3300031892 | Soil | DDAVLDDGTATGWSLYDLQTTTPVGWAAMARLTSSLG |
| Ga0310891_100734053 | 3300031913 | Soil | AEELQAFHDAVVDDGAAVGWSLYDLQTTTPAGWAAMARLGESLG |
| Ga0315278_116036472 | 3300031997 | Sediment | NRMTADELKAFADAVADEGTVTGWSLYDFQTTGPKGWAALAPLGTG |
| Ga0310890_104286953 | 3300032075 | Soil | MTADELRAFDDAVLDDGTATGWSLYDLQTTTPAGWAAMARLSSSLG |
| Ga0310890_118464101 | 3300032075 | Soil | RMTADELRAFDDAVLDDGTATGWSLYDLQTTTPVGWAAMARLTSSLG |
| Ga0315283_109322501 | 3300032164 | Sediment | DELKAFADAVADEGSITGWSLYDFQTTGPKGWAALAPLGTG |
| Ga0315287_127197482 | 3300032397 | Sediment | MTGDELKAFVDAVTDEGTVTGWSLYDFQTSGPKAWAALKPLGTG |
| Ga0247830_107997501 | 3300033551 | Soil | FDDAVLDDGTVTGWSLYDLQTATPAGWAAMARLSASLG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |