| Basic Information | |
|---|---|
| Family ID | F105270 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MAAGLALGGDVEQALSSVGVPSYVLDTTGVVRWINPAAERL |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 99 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 26.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.00 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.49% β-sheet: 10.14% Coil/Unstructured: 75.36% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 99 Family Scaffolds |
|---|---|---|
| PF01391 | Collagen | 14.14 |
| PF13229 | Beta_helix | 2.02 |
| PF07883 | Cupin_2 | 2.02 |
| PF01814 | Hemerythrin | 1.01 |
| PF01863 | YgjP-like | 1.01 |
| PF04545 | Sigma70_r4 | 1.01 |
| PF10502 | Peptidase_S26 | 1.01 |
| PF12697 | Abhydrolase_6 | 1.01 |
| PF13480 | Acetyltransf_6 | 1.01 |
| PF12840 | HTH_20 | 1.01 |
| PF00069 | Pkinase | 1.01 |
| PF05048 | NosD | 1.01 |
| PF00990 | GGDEF | 1.01 |
| PF05988 | DUF899 | 1.01 |
| PF10947 | DUF2628 | 1.01 |
| PF02195 | ParBc | 1.01 |
| PF00365 | PFK | 1.01 |
| PF14542 | Acetyltransf_CG | 1.01 |
| PF14110 | DUF4282 | 1.01 |
| PF00196 | GerE | 1.01 |
| COG ID | Name | Functional Category | % Frequency in 99 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.04 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 1.01 |
| COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 1.01 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.01 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.00 % |
| Unclassified | root | N/A | 32.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459006|GBPF9FW01CXZCZ | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 2189573004|GZGWRS402HF8C3 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0626202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 983 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104716234 | Not Available | 534 | Open in IMG/M |
| 3300000955|JGI1027J12803_103625576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1183 | Open in IMG/M |
| 3300000956|JGI10216J12902_110381172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2285 | Open in IMG/M |
| 3300000956|JGI10216J12902_123676883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300002568|C688J35102_120903437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae | 2166 | Open in IMG/M |
| 3300004157|Ga0062590_101220744 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300004479|Ga0062595_102041048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300005332|Ga0066388_103745746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 776 | Open in IMG/M |
| 3300005332|Ga0066388_108114361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300005337|Ga0070682_101322262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
| 3300005343|Ga0070687_100401021 | Not Available | 899 | Open in IMG/M |
| 3300005344|Ga0070661_101809774 | Not Available | 518 | Open in IMG/M |
| 3300005353|Ga0070669_101076338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
| 3300005356|Ga0070674_100041149 | All Organisms → cellular organisms → Bacteria | 3130 | Open in IMG/M |
| 3300005366|Ga0070659_100906724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
| 3300005366|Ga0070659_100906724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
| 3300005367|Ga0070667_100999216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300005435|Ga0070714_100109304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2446 | Open in IMG/M |
| 3300005439|Ga0070711_100608253 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300005526|Ga0073909_10341085 | Not Available | 692 | Open in IMG/M |
| 3300005535|Ga0070684_101172680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 722 | Open in IMG/M |
| 3300005549|Ga0070704_102263217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
| 3300005564|Ga0070664_100731068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli | 923 | Open in IMG/M |
| 3300005564|Ga0070664_101807641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis vancoresmycina | 580 | Open in IMG/M |
| 3300005578|Ga0068854_101765146 | Not Available | 567 | Open in IMG/M |
| 3300005614|Ga0068856_102447374 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005616|Ga0068852_102663044 | Not Available | 519 | Open in IMG/M |
| 3300005718|Ga0068866_11429994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300005764|Ga0066903_101314386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1352 | Open in IMG/M |
| 3300005764|Ga0066903_102545385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 991 | Open in IMG/M |
| 3300005764|Ga0066903_102638785 | Not Available | 974 | Open in IMG/M |
| 3300006358|Ga0068871_101497078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 638 | Open in IMG/M |
| 3300006854|Ga0075425_102287879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 601 | Open in IMG/M |
| 3300006881|Ga0068865_101614002 | Not Available | 583 | Open in IMG/M |
| 3300006969|Ga0075419_11017115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300009098|Ga0105245_13064509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 518 | Open in IMG/M |
| 3300009147|Ga0114129_13293353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
| 3300009156|Ga0111538_10614415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1378 | Open in IMG/M |
| 3300009176|Ga0105242_10190624 | Not Available | 1815 | Open in IMG/M |
| 3300009177|Ga0105248_13322338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300009553|Ga0105249_11602027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 724 | Open in IMG/M |
| 3300010040|Ga0126308_10137170 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
| 3300010043|Ga0126380_12021620 | Not Available | 528 | Open in IMG/M |
| 3300010362|Ga0126377_11925094 | Not Available | 667 | Open in IMG/M |
| 3300010362|Ga0126377_12842437 | Not Available | 558 | Open in IMG/M |
| 3300010373|Ga0134128_10150480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2631 | Open in IMG/M |
| 3300011000|Ga0138513_100004906 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300012910|Ga0157308_10337185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
| 3300012957|Ga0164303_10257021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1005 | Open in IMG/M |
| 3300012971|Ga0126369_13007299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300012986|Ga0164304_10868942 | Not Available | 702 | Open in IMG/M |
| 3300012987|Ga0164307_11270443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300012989|Ga0164305_11078151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300012989|Ga0164305_11157836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
| 3300013102|Ga0157371_10904844 | Not Available | 669 | Open in IMG/M |
| 3300013308|Ga0157375_13410476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
| 3300014968|Ga0157379_10689926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
| 3300014968|Ga0157379_11359582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 687 | Open in IMG/M |
| 3300014969|Ga0157376_12494619 | Not Available | 557 | Open in IMG/M |
| 3300015077|Ga0173483_10695777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300015372|Ga0132256_100789038 | Not Available | 1066 | Open in IMG/M |
| 3300015373|Ga0132257_103459337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
| 3300015374|Ga0132255_103127084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
| 3300015374|Ga0132255_103305456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300017792|Ga0163161_11074233 | Not Available | 691 | Open in IMG/M |
| 3300017792|Ga0163161_11263858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300017937|Ga0187809_10101366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 965 | Open in IMG/M |
| 3300018422|Ga0190265_11454883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 799 | Open in IMG/M |
| 3300024186|Ga0247688_1044765 | Not Available | 702 | Open in IMG/M |
| 3300024187|Ga0247672_1039307 | Not Available | 775 | Open in IMG/M |
| 3300025898|Ga0207692_10628113 | Not Available | 692 | Open in IMG/M |
| 3300025906|Ga0207699_10712133 | Not Available | 735 | Open in IMG/M |
| 3300025915|Ga0207693_10541550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 908 | Open in IMG/M |
| 3300025917|Ga0207660_11282476 | Not Available | 595 | Open in IMG/M |
| 3300025934|Ga0207686_11224092 | Not Available | 615 | Open in IMG/M |
| 3300025972|Ga0207668_11886421 | Not Available | 539 | Open in IMG/M |
| 3300027821|Ga0209811_10239782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 691 | Open in IMG/M |
| 3300027874|Ga0209465_10469558 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300028721|Ga0307315_10251163 | Not Available | 555 | Open in IMG/M |
| 3300028803|Ga0307281_10315393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300028876|Ga0307286_10345041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300031547|Ga0310887_10340572 | Not Available | 867 | Open in IMG/M |
| 3300031548|Ga0307408_101094641 | Not Available | 739 | Open in IMG/M |
| 3300031764|Ga0318535_10557060 | Not Available | 508 | Open in IMG/M |
| 3300031779|Ga0318566_10576444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300031799|Ga0318565_10569178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300031896|Ga0318551_10887307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
| 3300031911|Ga0307412_10039978 | All Organisms → cellular organisms → Bacteria | 3032 | Open in IMG/M |
| 3300031942|Ga0310916_11139028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300032001|Ga0306922_11754216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300032003|Ga0310897_10397841 | Not Available | 651 | Open in IMG/M |
| 3300032009|Ga0318563_10242986 | Not Available | 972 | Open in IMG/M |
| 3300032010|Ga0318569_10593113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300032017|Ga0310899_10315993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 729 | Open in IMG/M |
| 3300032076|Ga0306924_11987170 | Not Available | 600 | Open in IMG/M |
| 3300033550|Ga0247829_10083796 | Not Available | 2355 | Open in IMG/M |
| 3300033551|Ga0247830_10262644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1312 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.00% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.00% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.00% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| L01_06859540 | 2170459006 | Grass Soil | MASGLSVGATLSRALGSVGVPSYVLDKTGVVRWINPAAERLLGDVRG |
| FG2_06225220 | 2189573004 | Grass Soil | GDVEQALGSVGVPSYVLDTMGVVRWINPAAERLVGDVR |
| ICChiseqgaiiDRAFT_06262023 | 3300000033 | Soil | MGGDVEGALEAVSVPSYVLDSSGVVRWLNPAAMRLVGD |
| INPhiseqgaiiFebDRAFT_1047162341 | 3300000364 | Soil | MTRSVGGFGVGGDVELALSNVGVPSYVLDMTGVVRWINPAAERL |
| JGI1027J12803_1036255763 | 3300000955 | Soil | MASTTEGTALGGDVEGALGNMPVPSYILDTDGIVR |
| JGI10216J12902_1103811725 | 3300000956 | Soil | MATGLAVGGDVEQALRSVGVPSYVLDTTGVVRWINA |
| JGI10216J12902_1236768831 | 3300000956 | Soil | MTVGFAVGGDVERALESVGVPSYVLDTTGIVRWINPAAER |
| C688J35102_1209034372 | 3300002568 | Soil | MSSGLPSGGDLERALAAVSVPSYVLDTAGDVRWINAAAERLV |
| Ga0062590_1012207441 | 3300004157 | Soil | VATGLKVGGDVEQALESIAVPSYVLDNAGVVRWINPAAKQLVG |
| Ga0062595_1020410481 | 3300004479 | Soil | VHTREGRSRSGGDVEQGLGSVAVPSYVLDTTGVVRWINPAAERLVGDVRG |
| Ga0066388_1037457462 | 3300005332 | Tropical Forest Soil | VARGLAVEGDVERALDGVGVPSYVLDKAGVVRWINPAAER |
| Ga0066388_1081143611 | 3300005332 | Tropical Forest Soil | MGTRLGVGGDVELALENVGVPSYVLDTTGIVRWINPAAER |
| Ga0070682_1013222621 | 3300005337 | Corn Rhizosphere | MASTTEGLALGGDVEGALANILVPSYILDTDGVVRWINPAAERLLGN |
| Ga0070687_1004010211 | 3300005343 | Switchgrass Rhizosphere | MATRLKVGGDVEQALEDVGVPSYVLDSTGVVRWLNAAAERLV |
| Ga0070661_1018097742 | 3300005344 | Corn Rhizosphere | MRDTSAMATGLPASGDLQRALASVNVPSYVLDTTGGVRWLNAAAER |
| Ga0070669_1010763381 | 3300005353 | Switchgrass Rhizosphere | MATTGGGLALGGDVEQALTGIPVPSYVLDTGGVVRWINPAAE |
| Ga0070674_1000411495 | 3300005356 | Miscanthus Rhizosphere | MATTGGGLALGGDVEQALTGIPVPSYVLDTAGVVRWINPA |
| Ga0070659_1009067241 | 3300005366 | Corn Rhizosphere | MATGLKVGGDVEQALENVGVPSYVLDETGVVRWINAAAEQL |
| Ga0070659_1009067243 | 3300005366 | Corn Rhizosphere | MATRLKVGGDVEQALEDVGVPSYVLDSTGVVRWLNAAAERLVGDVRGRHF |
| Ga0070667_1009992161 | 3300005367 | Switchgrass Rhizosphere | LRLNDTVGMATTGGGLALGGDVEQALTGIPVPSYVLDTGGVVRWINPAA |
| Ga0070714_1001093045 | 3300005435 | Agricultural Soil | MATGLAVGGDVEQALNSVGVPSYVLDTAGVVRWLNPAAEQ |
| Ga0070711_1006082531 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSTAGGLPLGGDVEQALVGIPVPSYVLDADGVVRWLNPAAER |
| Ga0073909_103410851 | 3300005526 | Surface Soil | MANGLKVGGDVEQALNSVGVPSYVVDTTGVVRWINPAAE |
| Ga0070684_1011726801 | 3300005535 | Corn Rhizosphere | MSIGELSVMASTTEGLALGGDVEGALANILVPSYILDTDGVVRWI |
| Ga0070704_1022632171 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIGELSVMASTTEGLALGGDVEGALANILVPSYILDTDG |
| Ga0070664_1007310682 | 3300005564 | Corn Rhizosphere | MATGLPASGDLQRALASVNVPSYVLDTTGGVRWLNAAAESVG* |
| Ga0070664_1018076411 | 3300005564 | Corn Rhizosphere | LKVGGDVEQALESIAVPSYVLDNAGVVRWINPAAKQLVGDVRG |
| Ga0068854_1017651461 | 3300005578 | Corn Rhizosphere | LKVGGDVEQALENIAVPSYVLDNAGVVRWINQAAKQLV |
| Ga0068856_1024473741 | 3300005614 | Corn Rhizosphere | VSSGLTVGGDLERALHGVGVASYVLDAAGIVRWINPAAERLL |
| Ga0068852_1026630441 | 3300005616 | Corn Rhizosphere | MTTGLKVGGDVEKALEHIAVPSYVLDNTGVVRWIN |
| Ga0068866_114299942 | 3300005718 | Miscanthus Rhizosphere | MATTGGGLALGGDVEQALTGIPVPSYVLDTGGVVRWINP |
| Ga0066903_1013143863 | 3300005764 | Tropical Forest Soil | MASTTEGLALGGDVEGALANMPVPSYILDTDGIVRWIN |
| Ga0066903_1025453852 | 3300005764 | Tropical Forest Soil | LSIGHTVGMATVGGGLAVGGDVEQALTGIPVPSYVLDTEGVVRWINPA |
| Ga0066903_1026387852 | 3300005764 | Tropical Forest Soil | MRAGLAVGGDVERALANVNVPSYVLDTTGVVRWINPA |
| Ga0068871_1014970781 | 3300006358 | Miscanthus Rhizosphere | MATGLAVGGDVEKALESVGVPSYVLDTTGVVRWIN |
| Ga0075425_1022878791 | 3300006854 | Populus Rhizosphere | MRESAEGLAVGGDVERALNSVGVPSYVLDTTGVIRWINPAAERL |
| Ga0068865_1016140021 | 3300006881 | Miscanthus Rhizosphere | MATRLKVGGDVEQALEDVGVPSYVLDSTGVVRWLNAAAE |
| Ga0075419_110171152 | 3300006969 | Populus Rhizosphere | MAPTADGLAVGGDAERALAGIPVPSYVLDTDGVVR |
| Ga0105245_130645091 | 3300009098 | Miscanthus Rhizosphere | MVSGLTVGGDVERALSGISVPSYVLDTTGVVRWMNPAAKRL |
| Ga0114129_132933531 | 3300009147 | Populus Rhizosphere | MSSDHTAGMAPTGGGFAVGGDAERALAGIPVPSYVLDTDGVVRWINPAAERL |
| Ga0111538_106144153 | 3300009156 | Populus Rhizosphere | MAPTADGLAVGGDAERALAGIPVPSYVLDTDGVVRWINPAA |
| Ga0105242_101906245 | 3300009176 | Miscanthus Rhizosphere | MATGLKVGGDVEQALENVGVPSYVLDETGIVRWIN |
| Ga0105248_133223381 | 3300009177 | Switchgrass Rhizosphere | MAPTAGGLALGGDVEQALAGIPVPSYVLDTTGVVRWINPA |
| Ga0105249_116020271 | 3300009553 | Switchgrass Rhizosphere | MTTGLAVGGDVEQALSGVGVPSYVLDTTGIVRWINPAAERLLGDIRGRH |
| Ga0126308_101371701 | 3300010040 | Serpentine Soil | MATGLKVGGDVEQALSSVGFPSYVLDTTGVVRWINEAAERLV |
| Ga0126380_120216201 | 3300010043 | Tropical Forest Soil | MATAGGGLAVGGDVEQSLTGIPVPSYVLDTDGVVRWVNPAAE |
| Ga0126377_119250942 | 3300010362 | Tropical Forest Soil | MATGLNVEGDVEQALENIGVPSYVLDNTGIVRWINAAAKQLVGDVRG |
| Ga0126377_128424371 | 3300010362 | Tropical Forest Soil | MASTTEGLPLGGDLEQALAGIPVPSYVLDTDGLVRWLNPA |
| Ga0134128_101504801 | 3300010373 | Terrestrial Soil | MASTTEGLALGGDVEGALANILVPSYILDTDGVVRWIN |
| Ga0138513_1000049062 | 3300011000 | Soil | MGADVEDALEAISVPSYVLDSSVVVRWLNPAAERLLGD |
| Ga0157308_103371851 | 3300012910 | Soil | MATRLKVGGDVEQALEDVGVPSYVLDSTGVVRWLNAAAERLVGDV |
| Ga0164303_102570212 | 3300012957 | Soil | MASGLAVGGDIEKALESVGVPSYVLDNTGIVRWLNAAAERLVGDVRGR |
| Ga0126369_130072991 | 3300012971 | Tropical Forest Soil | MDGRPALGGDVEHALAHISVPSYVLDTDGVVRWLNPAAEQL |
| Ga0164304_108689424 | 3300012986 | Soil | MTRSVGGLAVGGDVELALNNVGVPSYVLDTTGLVRWIN |
| Ga0164307_112704432 | 3300012987 | Soil | MAMGLGVGFDVEQALANVGVPSYVLDTTGVVRWINPA |
| Ga0164305_110781511 | 3300012989 | Soil | MATGLKVGGDVEQALENVGIPSYVLDTTGIVRWINAAAERLVGDVRG |
| Ga0164305_111578362 | 3300012989 | Soil | MARTGGGLAVGGDVERALTGVPVPSYVLDTAGVVRWLN |
| Ga0157371_109048442 | 3300013102 | Corn Rhizosphere | MTTGLKVGGDVEKALEHIAVPSYVLDNAGVVRWIN |
| Ga0157375_134104762 | 3300013308 | Miscanthus Rhizosphere | MASGLTVGGDLEQALGRVGVPSYVLDTTGVVKWINEAAERL |
| Ga0157379_106899261 | 3300014968 | Switchgrass Rhizosphere | MIAGLAVGGDVERALEDVGVPSYVLDSTGVVRWLNAA |
| Ga0157379_113595822 | 3300014968 | Switchgrass Rhizosphere | MDRRPALGGDVELALAHISVPSYILDTDGIVRWVNPAAEQLLG |
| Ga0157376_124946193 | 3300014969 | Miscanthus Rhizosphere | MTRSVGGLAVGGDVELALNNVGVPSYVLDTTGLVRWINPAAQ |
| Ga0173483_106957772 | 3300015077 | Soil | MTTGLGVGGDVEQALESVGVPSYVLDTTGIVRWINP |
| Ga0132256_1007890382 | 3300015372 | Arabidopsis Rhizosphere | MATTGGGLEVGGDVEQALVGIPVPSYVLDTAGVVRWI |
| Ga0132257_1034593371 | 3300015373 | Arabidopsis Rhizosphere | MTTGLGVGGEVERALEGVSVPSYVLETTGSVRWINPAAERL |
| Ga0132255_1031270841 | 3300015374 | Arabidopsis Rhizosphere | MATGLAVHGNVEQALDNVGVPSYVLDTTGVVRWINPAAERLV |
| Ga0132255_1033054561 | 3300015374 | Arabidopsis Rhizosphere | MATGLKVGGDVEQALESVGVPSYVLDTTGIVRWLNPAAEQL |
| Ga0163161_110742332 | 3300017792 | Switchgrass Rhizosphere | MVSGLTVGGDVERALSGISVPSYVLDTTGVVRWMNPA |
| Ga0163161_112638582 | 3300017792 | Switchgrass Rhizosphere | MASTTEGTALGGDVEGALGNMPVPSYILDTDGIVRWLNPA |
| Ga0187809_101013662 | 3300017937 | Freshwater Sediment | MASTTGGLALGGDVEGALANILVPSYILDTDGIVRWVNPAAERLLGNIRG |
| Ga0190265_114548831 | 3300018422 | Soil | MATGLSVGGDVEQALSDVGVPSDVLDTTGVVRWINPAAERLVGDVRG |
| Ga0247688_10447652 | 3300024186 | Soil | MGTTGGGLAVGGDVEQALTGIPVPSYVLDREGIVRWINPAA |
| Ga0247672_10393071 | 3300024187 | Soil | MGTTGGGLAVGGDVEQALIGIPVPSYVLDREGIVRWINPAA |
| Ga0207692_106281132 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSTAGGLPLGGDVEQALVGIPVPSYVLDADGVVRWLN |
| Ga0207699_107121332 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MGTTGGGLAVGGDVEQALTGIPVPSYVLDREGIVRWINPAAE |
| Ga0207693_105415501 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSTAGGLPLGGDVEQALVGIPVPSYVLDADGVVRWLNPAA |
| Ga0207660_112824762 | 3300025917 | Corn Rhizosphere | MPADGYLDEVAGGLGVAGDVEGALASVSVPSYVLDDFGVIRWINPAA |
| Ga0207686_112240921 | 3300025934 | Miscanthus Rhizosphere | MATGLKVGGDVEQALDGVGVPSYVLDTTGVVRWINAA |
| Ga0207668_118864211 | 3300025972 | Switchgrass Rhizosphere | MATGLKVGGDVEQALENVGVPSYVLDHTGVVRWINAAAEQLV |
| Ga0209811_102397822 | 3300027821 | Surface Soil | VGPTTGGLAVGGDVELALVGLPVPSYVLDTTGVVRWINPAAERL |
| Ga0209465_104695582 | 3300027874 | Tropical Forest Soil | MASTTEGLALGGDVEGALAKLLVPSYILDTDGVVRWINPAAWAALNPAST |
| Ga0307315_102511631 | 3300028721 | Soil | MSDLEEMGGDVEAALEAISVPSYVLDSAGVIRWLNPA |
| Ga0307281_103153931 | 3300028803 | Soil | MATGFSVGGDIEQALGDVGVPSYVLDTTGVVRWINPAAERL |
| Ga0307286_103450412 | 3300028876 | Soil | MATGFSVGGDIEQALGDVGVPSYVLDTTGVVRWINPAAERLV |
| Ga0310887_103405721 | 3300031547 | Soil | LGVGGDVERALEDVGVPSYVLDEAGIVRWINANDT |
| Ga0307408_1010946411 | 3300031548 | Rhizosphere | MLGEMGGDVEGALEAISVPSYVLDSSGVVRWLNPAAER |
| Ga0318535_105570602 | 3300031764 | Soil | MAGGFAGGDIERALDSVGVPSYVLDTTGVVRWINPAA |
| Ga0318566_105764441 | 3300031779 | Soil | MARTAGGLAVGGDVERALAGILVPSYVLDTDGVVRWINPAAERLL |
| Ga0318565_105691782 | 3300031799 | Soil | VASNTEGIALGGDVEGALANLLVPSYILDTAGIVRWINPAAERLLGSRV |
| Ga0318551_108873072 | 3300031896 | Soil | MSGVLGIGGDVERALEGVGVASYVLDTTGVIRWLNPAAERLVGDV |
| Ga0307412_100399781 | 3300031911 | Rhizosphere | MLEEMGGDVEGALEAISVPSYVLDSSGVVRWLNPAAERL |
| Ga0310916_111390281 | 3300031942 | Soil | VVHGLAVGGDVERALANVNVPSYVLDTTGVVRWINPAA |
| Ga0306922_117542162 | 3300032001 | Soil | MATGLAVGGDVEQALARVGIPSYVLDTTGNVRWINPAAERLLG |
| Ga0310897_103978411 | 3300032003 | Soil | MGTTGGGLAVGGDVEQALTGIPVPSYVLDREGIVRWIN |
| Ga0318563_102429862 | 3300032009 | Soil | MAAGLALGGDVEQALSSVGVPSYVLDTTGVVRWINPAAERL |
| Ga0318569_105931132 | 3300032010 | Soil | MASTTSGLALGGDVEAALAKILVPSYILDTDGVIRWINPAAERLL |
| Ga0310899_103159932 | 3300032017 | Soil | MAAGMPMDADVERALEDIGVPSYVLDTAGVVRWINP |
| Ga0306924_119871701 | 3300032076 | Soil | MASTAGGLALGGSVEQALTGIPVPSYVLDTDGLVRWLNPAAERLL |
| Ga0247829_100837964 | 3300033550 | Soil | MATGLKVGGDVEQALENVGVPSYVLDETGVVRWINAAA |
| Ga0247830_102626444 | 3300033551 | Soil | MATTAGGLAVGGDVEQALAGIPVPSYVLDTNGVVRWL |
| ⦗Top⦘ |