NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F105270

Metagenome Family F105270

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105270
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 41 residues
Representative Sequence MAAGLALGGDVEQALSSVGVPSYVLDTTGVVRWINPAAERL
Number of Associated Samples 89
Number of Associated Scaffolds 99

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 26.00 %
% of genes near scaffold ends (potentially truncated) 97.00 %
% of genes from short scaffolds (< 2000 bps) 93.00 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.000 % of family members)
Environment Ontology (ENVO) Unclassified
(34.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.49%    β-sheet: 10.14%    Coil/Unstructured: 75.36%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 99 Family Scaffolds
PF01391Collagen 14.14
PF13229Beta_helix 2.02
PF07883Cupin_2 2.02
PF01814Hemerythrin 1.01
PF01863YgjP-like 1.01
PF04545Sigma70_r4 1.01
PF10502Peptidase_S26 1.01
PF12697Abhydrolase_6 1.01
PF13480Acetyltransf_6 1.01
PF12840HTH_20 1.01
PF00069Pkinase 1.01
PF05048NosD 1.01
PF00990GGDEF 1.01
PF05988DUF899 1.01
PF10947DUF2628 1.01
PF02195ParBc 1.01
PF00365PFK 1.01
PF14542Acetyltransf_CG 1.01
PF14110DUF4282 1.01
PF00196GerE 1.01

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 99 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 4.04
COG02056-phosphofructokinaseCarbohydrate transport and metabolism [G] 1.01
COG1451UTP pyrophosphatase, metal-dependent hydrolase familyGeneral function prediction only [R] 1.01
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 1.01

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.00 %
UnclassifiedrootN/A32.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459006|GBPF9FW01CXZCZAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
2189573004|GZGWRS402HF8C3All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0626202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium983Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104716234Not Available534Open in IMG/M
3300000955|JGI1027J12803_103625576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1183Open in IMG/M
3300000956|JGI10216J12902_110381172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes2285Open in IMG/M
3300000956|JGI10216J12902_123676883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300002568|C688J35102_120903437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae2166Open in IMG/M
3300004157|Ga0062590_101220744All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300004479|Ga0062595_102041048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria555Open in IMG/M
3300005332|Ga0066388_103745746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium776Open in IMG/M
3300005332|Ga0066388_108114361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300005337|Ga0070682_101322262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia613Open in IMG/M
3300005343|Ga0070687_100401021Not Available899Open in IMG/M
3300005344|Ga0070661_101809774Not Available518Open in IMG/M
3300005353|Ga0070669_101076338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium692Open in IMG/M
3300005356|Ga0070674_100041149All Organisms → cellular organisms → Bacteria3130Open in IMG/M
3300005366|Ga0070659_100906724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria770Open in IMG/M
3300005366|Ga0070659_100906724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria770Open in IMG/M
3300005367|Ga0070667_100999216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium781Open in IMG/M
3300005435|Ga0070714_100109304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2446Open in IMG/M
3300005439|Ga0070711_100608253All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300005526|Ga0073909_10341085Not Available692Open in IMG/M
3300005535|Ga0070684_101172680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia722Open in IMG/M
3300005549|Ga0070704_102263217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300005564|Ga0070664_100731068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli923Open in IMG/M
3300005564|Ga0070664_101807641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis vancoresmycina580Open in IMG/M
3300005578|Ga0068854_101765146Not Available567Open in IMG/M
3300005614|Ga0068856_102447374All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005616|Ga0068852_102663044Not Available519Open in IMG/M
3300005718|Ga0068866_11429994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300005764|Ga0066903_101314386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1352Open in IMG/M
3300005764|Ga0066903_102545385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia991Open in IMG/M
3300005764|Ga0066903_102638785Not Available974Open in IMG/M
3300006358|Ga0068871_101497078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium638Open in IMG/M
3300006854|Ga0075425_102287879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300006881|Ga0068865_101614002Not Available583Open in IMG/M
3300006969|Ga0075419_11017115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia604Open in IMG/M
3300009098|Ga0105245_13064509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia518Open in IMG/M
3300009147|Ga0114129_13293353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300009156|Ga0111538_10614415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1378Open in IMG/M
3300009176|Ga0105242_10190624Not Available1815Open in IMG/M
3300009177|Ga0105248_13322338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300009553|Ga0105249_11602027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium724Open in IMG/M
3300010040|Ga0126308_10137170All Organisms → cellular organisms → Bacteria1534Open in IMG/M
3300010043|Ga0126380_12021620Not Available528Open in IMG/M
3300010362|Ga0126377_11925094Not Available667Open in IMG/M
3300010362|Ga0126377_12842437Not Available558Open in IMG/M
3300010373|Ga0134128_10150480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2631Open in IMG/M
3300011000|Ga0138513_100004906All Organisms → cellular organisms → Bacteria1480Open in IMG/M
3300012910|Ga0157308_10337185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300012957|Ga0164303_10257021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1005Open in IMG/M
3300012971|Ga0126369_13007299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300012986|Ga0164304_10868942Not Available702Open in IMG/M
3300012987|Ga0164307_11270443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia614Open in IMG/M
3300012989|Ga0164305_11078151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300012989|Ga0164305_11157836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia668Open in IMG/M
3300013102|Ga0157371_10904844Not Available669Open in IMG/M
3300013308|Ga0157375_13410476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium529Open in IMG/M
3300014968|Ga0157379_10689926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria958Open in IMG/M
3300014968|Ga0157379_11359582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia687Open in IMG/M
3300014969|Ga0157376_12494619Not Available557Open in IMG/M
3300015077|Ga0173483_10695777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300015372|Ga0132256_100789038Not Available1066Open in IMG/M
3300015373|Ga0132257_103459337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia574Open in IMG/M
3300015374|Ga0132255_103127084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria706Open in IMG/M
3300015374|Ga0132255_103305456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300017792|Ga0163161_11074233Not Available691Open in IMG/M
3300017792|Ga0163161_11263858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia640Open in IMG/M
3300017937|Ga0187809_10101366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria965Open in IMG/M
3300018422|Ga0190265_11454883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria799Open in IMG/M
3300024186|Ga0247688_1044765Not Available702Open in IMG/M
3300024187|Ga0247672_1039307Not Available775Open in IMG/M
3300025898|Ga0207692_10628113Not Available692Open in IMG/M
3300025906|Ga0207699_10712133Not Available735Open in IMG/M
3300025915|Ga0207693_10541550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia908Open in IMG/M
3300025917|Ga0207660_11282476Not Available595Open in IMG/M
3300025934|Ga0207686_11224092Not Available615Open in IMG/M
3300025972|Ga0207668_11886421Not Available539Open in IMG/M
3300027821|Ga0209811_10239782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia691Open in IMG/M
3300027874|Ga0209465_10469558All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300028721|Ga0307315_10251163Not Available555Open in IMG/M
3300028803|Ga0307281_10315393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria586Open in IMG/M
3300028876|Ga0307286_10345041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300031547|Ga0310887_10340572Not Available867Open in IMG/M
3300031548|Ga0307408_101094641Not Available739Open in IMG/M
3300031764|Ga0318535_10557060Not Available508Open in IMG/M
3300031779|Ga0318566_10576444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia549Open in IMG/M
3300031799|Ga0318565_10569178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300031896|Ga0318551_10887307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300031911|Ga0307412_10039978All Organisms → cellular organisms → Bacteria3032Open in IMG/M
3300031942|Ga0310916_11139028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria647Open in IMG/M
3300032001|Ga0306922_11754216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
3300032003|Ga0310897_10397841Not Available651Open in IMG/M
3300032009|Ga0318563_10242986Not Available972Open in IMG/M
3300032010|Ga0318569_10593113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia516Open in IMG/M
3300032017|Ga0310899_10315993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium729Open in IMG/M
3300032076|Ga0306924_11987170Not Available600Open in IMG/M
3300033550|Ga0247829_10083796Not Available2355Open in IMG/M
3300033551|Ga0247830_10262644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1312Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere5.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.00%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.00%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil1.00%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.00%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.00%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459006Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cmEnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300024186Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
L01_068595402170459006Grass SoilMASGLSVGATLSRALGSVGVPSYVLDKTGVVRWINPAAERLLGDVRG
FG2_062252202189573004Grass SoilGDVEQALGSVGVPSYVLDTMGVVRWINPAAERLVGDVR
ICChiseqgaiiDRAFT_062620233300000033SoilMGGDVEGALEAVSVPSYVLDSSGVVRWLNPAAMRLVGD
INPhiseqgaiiFebDRAFT_10471623413300000364SoilMTRSVGGFGVGGDVELALSNVGVPSYVLDMTGVVRWINPAAERL
JGI1027J12803_10362557633300000955SoilMASTTEGTALGGDVEGALGNMPVPSYILDTDGIVR
JGI10216J12902_11038117253300000956SoilMATGLAVGGDVEQALRSVGVPSYVLDTTGVVRWINA
JGI10216J12902_12367688313300000956SoilMTVGFAVGGDVERALESVGVPSYVLDTTGIVRWINPAAER
C688J35102_12090343723300002568SoilMSSGLPSGGDLERALAAVSVPSYVLDTAGDVRWINAAAERLV
Ga0062590_10122074413300004157SoilVATGLKVGGDVEQALESIAVPSYVLDNAGVVRWINPAAKQLVG
Ga0062595_10204104813300004479SoilVHTREGRSRSGGDVEQGLGSVAVPSYVLDTTGVVRWINPAAERLVGDVRG
Ga0066388_10374574623300005332Tropical Forest SoilVARGLAVEGDVERALDGVGVPSYVLDKAGVVRWINPAAER
Ga0066388_10811436113300005332Tropical Forest SoilMGTRLGVGGDVELALENVGVPSYVLDTTGIVRWINPAAER
Ga0070682_10132226213300005337Corn RhizosphereMASTTEGLALGGDVEGALANILVPSYILDTDGVVRWINPAAERLLGN
Ga0070687_10040102113300005343Switchgrass RhizosphereMATRLKVGGDVEQALEDVGVPSYVLDSTGVVRWLNAAAERLV
Ga0070661_10180977423300005344Corn RhizosphereMRDTSAMATGLPASGDLQRALASVNVPSYVLDTTGGVRWLNAAAER
Ga0070669_10107633813300005353Switchgrass RhizosphereMATTGGGLALGGDVEQALTGIPVPSYVLDTGGVVRWINPAAE
Ga0070674_10004114953300005356Miscanthus RhizosphereMATTGGGLALGGDVEQALTGIPVPSYVLDTAGVVRWINPA
Ga0070659_10090672413300005366Corn RhizosphereMATGLKVGGDVEQALENVGVPSYVLDETGVVRWINAAAEQL
Ga0070659_10090672433300005366Corn RhizosphereMATRLKVGGDVEQALEDVGVPSYVLDSTGVVRWLNAAAERLVGDVRGRHF
Ga0070667_10099921613300005367Switchgrass RhizosphereLRLNDTVGMATTGGGLALGGDVEQALTGIPVPSYVLDTGGVVRWINPAA
Ga0070714_10010930453300005435Agricultural SoilMATGLAVGGDVEQALNSVGVPSYVLDTAGVVRWLNPAAEQ
Ga0070711_10060825313300005439Corn, Switchgrass And Miscanthus RhizosphereMPSTAGGLPLGGDVEQALVGIPVPSYVLDADGVVRWLNPAAER
Ga0073909_1034108513300005526Surface SoilMANGLKVGGDVEQALNSVGVPSYVVDTTGVVRWINPAAE
Ga0070684_10117268013300005535Corn RhizosphereMSIGELSVMASTTEGLALGGDVEGALANILVPSYILDTDGVVRWI
Ga0070704_10226321713300005549Corn, Switchgrass And Miscanthus RhizosphereMSIGELSVMASTTEGLALGGDVEGALANILVPSYILDTDG
Ga0070664_10073106823300005564Corn RhizosphereMATGLPASGDLQRALASVNVPSYVLDTTGGVRWLNAAAESVG*
Ga0070664_10180764113300005564Corn RhizosphereLKVGGDVEQALESIAVPSYVLDNAGVVRWINPAAKQLVGDVRG
Ga0068854_10176514613300005578Corn RhizosphereLKVGGDVEQALENIAVPSYVLDNAGVVRWINQAAKQLV
Ga0068856_10244737413300005614Corn RhizosphereVSSGLTVGGDLERALHGVGVASYVLDAAGIVRWINPAAERLL
Ga0068852_10266304413300005616Corn RhizosphereMTTGLKVGGDVEKALEHIAVPSYVLDNTGVVRWIN
Ga0068866_1142999423300005718Miscanthus RhizosphereMATTGGGLALGGDVEQALTGIPVPSYVLDTGGVVRWINP
Ga0066903_10131438633300005764Tropical Forest SoilMASTTEGLALGGDVEGALANMPVPSYILDTDGIVRWIN
Ga0066903_10254538523300005764Tropical Forest SoilLSIGHTVGMATVGGGLAVGGDVEQALTGIPVPSYVLDTEGVVRWINPA
Ga0066903_10263878523300005764Tropical Forest SoilMRAGLAVGGDVERALANVNVPSYVLDTTGVVRWINPA
Ga0068871_10149707813300006358Miscanthus RhizosphereMATGLAVGGDVEKALESVGVPSYVLDTTGVVRWIN
Ga0075425_10228787913300006854Populus RhizosphereMRESAEGLAVGGDVERALNSVGVPSYVLDTTGVIRWINPAAERL
Ga0068865_10161400213300006881Miscanthus RhizosphereMATRLKVGGDVEQALEDVGVPSYVLDSTGVVRWLNAAAE
Ga0075419_1101711523300006969Populus RhizosphereMAPTADGLAVGGDAERALAGIPVPSYVLDTDGVVR
Ga0105245_1306450913300009098Miscanthus RhizosphereMVSGLTVGGDVERALSGISVPSYVLDTTGVVRWMNPAAKRL
Ga0114129_1329335313300009147Populus RhizosphereMSSDHTAGMAPTGGGFAVGGDAERALAGIPVPSYVLDTDGVVRWINPAAERL
Ga0111538_1061441533300009156Populus RhizosphereMAPTADGLAVGGDAERALAGIPVPSYVLDTDGVVRWINPAA
Ga0105242_1019062453300009176Miscanthus RhizosphereMATGLKVGGDVEQALENVGVPSYVLDETGIVRWIN
Ga0105248_1332233813300009177Switchgrass RhizosphereMAPTAGGLALGGDVEQALAGIPVPSYVLDTTGVVRWINPA
Ga0105249_1160202713300009553Switchgrass RhizosphereMTTGLAVGGDVEQALSGVGVPSYVLDTTGIVRWINPAAERLLGDIRGRH
Ga0126308_1013717013300010040Serpentine SoilMATGLKVGGDVEQALSSVGFPSYVLDTTGVVRWINEAAERLV
Ga0126380_1202162013300010043Tropical Forest SoilMATAGGGLAVGGDVEQSLTGIPVPSYVLDTDGVVRWVNPAAE
Ga0126377_1192509423300010362Tropical Forest SoilMATGLNVEGDVEQALENIGVPSYVLDNTGIVRWINAAAKQLVGDVRG
Ga0126377_1284243713300010362Tropical Forest SoilMASTTEGLPLGGDLEQALAGIPVPSYVLDTDGLVRWLNPA
Ga0134128_1015048013300010373Terrestrial SoilMASTTEGLALGGDVEGALANILVPSYILDTDGVVRWIN
Ga0138513_10000490623300011000SoilMGADVEDALEAISVPSYVLDSSVVVRWLNPAAERLLGD
Ga0157308_1033718513300012910SoilMATRLKVGGDVEQALEDVGVPSYVLDSTGVVRWLNAAAERLVGDV
Ga0164303_1025702123300012957SoilMASGLAVGGDIEKALESVGVPSYVLDNTGIVRWLNAAAERLVGDVRGR
Ga0126369_1300729913300012971Tropical Forest SoilMDGRPALGGDVEHALAHISVPSYVLDTDGVVRWLNPAAEQL
Ga0164304_1086894243300012986SoilMTRSVGGLAVGGDVELALNNVGVPSYVLDTTGLVRWIN
Ga0164307_1127044323300012987SoilMAMGLGVGFDVEQALANVGVPSYVLDTTGVVRWINPA
Ga0164305_1107815113300012989SoilMATGLKVGGDVEQALENVGIPSYVLDTTGIVRWINAAAERLVGDVRG
Ga0164305_1115783623300012989SoilMARTGGGLAVGGDVERALTGVPVPSYVLDTAGVVRWLN
Ga0157371_1090484423300013102Corn RhizosphereMTTGLKVGGDVEKALEHIAVPSYVLDNAGVVRWIN
Ga0157375_1341047623300013308Miscanthus RhizosphereMASGLTVGGDLEQALGRVGVPSYVLDTTGVVKWINEAAERL
Ga0157379_1068992613300014968Switchgrass RhizosphereMIAGLAVGGDVERALEDVGVPSYVLDSTGVVRWLNAA
Ga0157379_1135958223300014968Switchgrass RhizosphereMDRRPALGGDVELALAHISVPSYILDTDGIVRWVNPAAEQLLG
Ga0157376_1249461933300014969Miscanthus RhizosphereMTRSVGGLAVGGDVELALNNVGVPSYVLDTTGLVRWINPAAQ
Ga0173483_1069577723300015077SoilMTTGLGVGGDVEQALESVGVPSYVLDTTGIVRWINP
Ga0132256_10078903823300015372Arabidopsis RhizosphereMATTGGGLEVGGDVEQALVGIPVPSYVLDTAGVVRWI
Ga0132257_10345933713300015373Arabidopsis RhizosphereMTTGLGVGGEVERALEGVSVPSYVLETTGSVRWINPAAERL
Ga0132255_10312708413300015374Arabidopsis RhizosphereMATGLAVHGNVEQALDNVGVPSYVLDTTGVVRWINPAAERLV
Ga0132255_10330545613300015374Arabidopsis RhizosphereMATGLKVGGDVEQALESVGVPSYVLDTTGIVRWLNPAAEQL
Ga0163161_1107423323300017792Switchgrass RhizosphereMVSGLTVGGDVERALSGISVPSYVLDTTGVVRWMNPA
Ga0163161_1126385823300017792Switchgrass RhizosphereMASTTEGTALGGDVEGALGNMPVPSYILDTDGIVRWLNPA
Ga0187809_1010136623300017937Freshwater SedimentMASTTGGLALGGDVEGALANILVPSYILDTDGIVRWVNPAAERLLGNIRG
Ga0190265_1145488313300018422SoilMATGLSVGGDVEQALSDVGVPSDVLDTTGVVRWINPAAERLVGDVRG
Ga0247688_104476523300024186SoilMGTTGGGLAVGGDVEQALTGIPVPSYVLDREGIVRWINPAA
Ga0247672_103930713300024187SoilMGTTGGGLAVGGDVEQALIGIPVPSYVLDREGIVRWINPAA
Ga0207692_1062811323300025898Corn, Switchgrass And Miscanthus RhizosphereMPSTAGGLPLGGDVEQALVGIPVPSYVLDADGVVRWLN
Ga0207699_1071213323300025906Corn, Switchgrass And Miscanthus RhizosphereMGTTGGGLAVGGDVEQALTGIPVPSYVLDREGIVRWINPAAE
Ga0207693_1054155013300025915Corn, Switchgrass And Miscanthus RhizosphereMPSTAGGLPLGGDVEQALVGIPVPSYVLDADGVVRWLNPAA
Ga0207660_1128247623300025917Corn RhizosphereMPADGYLDEVAGGLGVAGDVEGALASVSVPSYVLDDFGVIRWINPAA
Ga0207686_1122409213300025934Miscanthus RhizosphereMATGLKVGGDVEQALDGVGVPSYVLDTTGVVRWINAA
Ga0207668_1188642113300025972Switchgrass RhizosphereMATGLKVGGDVEQALENVGVPSYVLDHTGVVRWINAAAEQLV
Ga0209811_1023978223300027821Surface SoilVGPTTGGLAVGGDVELALVGLPVPSYVLDTTGVVRWINPAAERL
Ga0209465_1046955823300027874Tropical Forest SoilMASTTEGLALGGDVEGALAKLLVPSYILDTDGVVRWINPAAWAALNPAST
Ga0307315_1025116313300028721SoilMSDLEEMGGDVEAALEAISVPSYVLDSAGVIRWLNPA
Ga0307281_1031539313300028803SoilMATGFSVGGDIEQALGDVGVPSYVLDTTGVVRWINPAAERL
Ga0307286_1034504123300028876SoilMATGFSVGGDIEQALGDVGVPSYVLDTTGVVRWINPAAERLV
Ga0310887_1034057213300031547SoilLGVGGDVERALEDVGVPSYVLDEAGIVRWINANDT
Ga0307408_10109464113300031548RhizosphereMLGEMGGDVEGALEAISVPSYVLDSSGVVRWLNPAAER
Ga0318535_1055706023300031764SoilMAGGFAGGDIERALDSVGVPSYVLDTTGVVRWINPAA
Ga0318566_1057644413300031779SoilMARTAGGLAVGGDVERALAGILVPSYVLDTDGVVRWINPAAERLL
Ga0318565_1056917823300031799SoilVASNTEGIALGGDVEGALANLLVPSYILDTAGIVRWINPAAERLLGSRV
Ga0318551_1088730723300031896SoilMSGVLGIGGDVERALEGVGVASYVLDTTGVIRWLNPAAERLVGDV
Ga0307412_1003997813300031911RhizosphereMLEEMGGDVEGALEAISVPSYVLDSSGVVRWLNPAAERL
Ga0310916_1113902813300031942SoilVVHGLAVGGDVERALANVNVPSYVLDTTGVVRWINPAA
Ga0306922_1175421623300032001SoilMATGLAVGGDVEQALARVGIPSYVLDTTGNVRWINPAAERLLG
Ga0310897_1039784113300032003SoilMGTTGGGLAVGGDVEQALTGIPVPSYVLDREGIVRWIN
Ga0318563_1024298623300032009SoilMAAGLALGGDVEQALSSVGVPSYVLDTTGVVRWINPAAERL
Ga0318569_1059311323300032010SoilMASTTSGLALGGDVEAALAKILVPSYILDTDGVIRWINPAAERLL
Ga0310899_1031599323300032017SoilMAAGMPMDADVERALEDIGVPSYVLDTAGVVRWINP
Ga0306924_1198717013300032076SoilMASTAGGLALGGSVEQALTGIPVPSYVLDTDGLVRWLNPAAERLL
Ga0247829_1008379643300033550SoilMATGLKVGGDVEQALENVGVPSYVLDETGVVRWINAAA
Ga0247830_1026264443300033551SoilMATTAGGLAVGGDVEQALAGIPVPSYVLDTNGVVRWL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.