| Basic Information | |
|---|---|
| Family ID | F105225 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MYVLTIGSIVYLYDNEKDARKAFHQSVAKNGINNVKVTYV |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 73.00 % |
| % of genes near scaffold ends (potentially truncated) | 27.00 % |
| % of genes from short scaffolds (< 2000 bps) | 79.00 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine (21.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (96.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 22.06% Coil/Unstructured: 51.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01521 | Fe-S_biosyn | 5.00 |
| PF13759 | 2OG-FeII_Oxy_5 | 2.00 |
| PF00478 | IMPDH | 1.00 |
| PF04434 | SWIM | 1.00 |
| PF06067 | DUF932 | 1.00 |
| PF09293 | RNaseH_C | 1.00 |
| PF13392 | HNH_3 | 1.00 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.00 |
| PF04055 | Radical_SAM | 1.00 |
| PF02543 | Carbam_trans_N | 1.00 |
| PF01467 | CTP_transf_like | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 5.00 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 5.00 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 1.00 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 1.00 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 1.00 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.00 % |
| All Organisms | root | All Organisms | 33.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 21.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 16.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.00% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 6.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 5.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.00% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 3.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.00% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.00% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 3.00% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.00% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.00% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.00% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001778 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM18, ROCA_DNA027_0.2um_3g | Environmental | Open in IMG/M |
| 3300001830 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM40, ROCA_DNA028_0.2um_3l | Environmental | Open in IMG/M |
| 3300001834 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM2, ROCA_DNA019_0.2um_2g | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300005433 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006404 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006405 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009049 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009443 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016743 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020174 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041409US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022900 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG | Environmental | Open in IMG/M |
| 3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
| 3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
| 3300023709 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300026136 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101729642 | 3300000101 | Marine | MYVLTIGTTTYLYDNETDARKAFHESVVKNGINNVKVTYNG* |
| DelMOWin2010_100015747 | 3300000117 | Marine | MYVLTIGSIVYLYDNEKDARKAFHQSVAKNGINNVKVTYV* |
| BBAY92_100270192 | 3300000947 | Macroalgal Surface | VYKLVIGKIVYLFACEHEARAAYHEAVEKNGINNVEVTYYD* |
| JGI20158J14315_1000268019 | 3300001355 | Pelagic Marine | MYVLTIGSIVYLYDNEKDARKAFHQSVVKNGINNVKVTYV* |
| ACM18_10681022 | 3300001778 | Marine Plankton | MYVLTINGIVYLYDNEKTARKAYHESVAKNGLENVTIEKKNILYW* |
| ACM40_10025401 | 3300001830 | Marine Plankton | MYVLTINGIVYLYDNEKTARKAYHESVAKNGINNVSITCK* |
| ACM2_10259232 | 3300001834 | Marine Plankton | MYVLTINGIVYLYDNEKTARKAYHESVAKNDINNVSITCK* |
| Ga0055584_1012680882 | 3300004097 | Pelagic Marine | MYVITIGSIVYLYDNETDARKAFHESVVKNGINNVKVTYNG* |
| Ga0066830_100261432 | 3300005433 | Marine | MYKVIIGNIVYLYDNEKDARKAYHVAVEKNGINNVEVSYE* |
| Ga0070743_101200103 | 3300005941 | Estuarine | MYVLTIGSIVYLYDNEKDARKAFHQSVATNGINNVKVTYV* |
| Ga0075515_101417373 | 3300006404 | Aqueous | MYVLTIGSIVYLYDNETDARKAFHESVVKNGINNVKVTYNG* |
| Ga0075510_111178202 | 3300006405 | Aqueous | MYVLTIGTITYLYDNEKDARKAFHQSVATNGINNVKVTYV* |
| Ga0098048_12356432 | 3300006752 | Marine | MYVLTIGSIVYLYDNDKDARKAYHHAVQKNGINNVKVTYND* |
| Ga0075479_100096326 | 3300006870 | Aqueous | MYVLTIGSIVYLYDNEKDARKAFHQSVAKNGINNVKVKYV* |
| Ga0075475_100495762 | 3300006874 | Aqueous | MYVLTIGTIVYLYDNEKEARKAFHQSVAKNGINNVKVTYV* |
| Ga0098046_10184372 | 3300006990 | Marine | MYVLTIGSIVYLYDNDKCARKAFHLAVQKNGINNVKVTYNG* |
| Ga0070747_13164981 | 3300007276 | Aqueous | MYVLTIGTITYLYDNEKEARKAFHQSVATNGINNVKVTYV* |
| Ga0102821_11012042 | 3300007557 | Estuarine | MYVLTIGTITYLYDNEKEARKAFHQSVAKNGINNVEVTYV* |
| Ga0102906_10802772 | 3300007637 | Estuarine | MYVLTIGTITYLYDNEKEARKAFHQSVAKNGINNVKVTYV* |
| Ga0102963_10116662 | 3300009001 | Pond Water | MYTLTIGSIVYLFDNDKDARSAFHQAVSKNGINNVKVTYND* |
| Ga0102963_11771911 | 3300009001 | Pond Water | MKNQGESMYKVIIGDIVYLYDNVKEARKAFHIAVSKNGINNVKVTYHGE* |
| Ga0102957_12977412 | 3300009027 | Pond Water | MYTLTIGSIVYLFDNDKDARKAFHQAVSKNGINNVKVTYND* |
| Ga0102911_11952802 | 3300009049 | Estuarine | MYVLTIGSIVYLYDNEKDARKAFHQSVAKNGINNVEVTYV* |
| Ga0115566_101872653 | 3300009071 | Pelagic Marine | MYVLTINGIVYLYDNEKDARKAFHESVAKNGLDNVKITKETL* |
| Ga0115566_101924863 | 3300009071 | Pelagic Marine | MYILTIGSIVYMYDNEKEARKAFHQAVQKNNINNVKVVYNG* |
| Ga0115566_104931252 | 3300009071 | Pelagic Marine | MYVLTIGSIVYLYDNEKDARKAFHQAVQKNNINNVKVKYV* |
| Ga0115552_100298417 | 3300009077 | Pelagic Marine | MYVLTIGSIVYLYDNEKDARKAFHQSVVKNGINNVKVKYV* |
| Ga0102815_103644301 | 3300009080 | Estuarine | MYVLTIGTITYLYDNEKDARKAFHQSVTKNGINNVKVTYV* |
| Ga0115545_11564013 | 3300009433 | Pelagic Marine | MYVLTIGSIVYLYDNEKDARKAFHQSVVKNGINNVK |
| Ga0115561_12513351 | 3300009440 | Pelagic Marine | VLTIGSIVTLYDNEKDARKSYHQSVAKNGINNVKVKYV* |
| Ga0115557_11189082 | 3300009443 | Pelagic Marine | MYVLTIGSIVTLYDNEKDARKAYHQSVAKNGINNVKVKYV* |
| Ga0115560_13372822 | 3300009447 | Pelagic Marine | YVLTIGSIVTLYDNEKDARKAYHQSVAKNGINNVKVKYV* |
| Ga0115558_14439211 | 3300009449 | Pelagic Marine | MYILTIGSIVYMYDNEKEARKAFHQAVQKNNINNVKV |
| Ga0115565_104301542 | 3300009467 | Pelagic Marine | MYVLTIGSIVYLYDNEKDARKAFHQAVQKNNINNVKVTYV* |
| Ga0115554_10280539 | 3300009472 | Pelagic Marine | MYVLTIGSIVYLYDNEKDARKAYHQSVAKNGINNVKVKYV* |
| Ga0115554_11024711 | 3300009472 | Pelagic Marine | LVSRVYQYDNEKDARKAFHQSVVKNGINNVKVTYV* |
| Ga0115555_14313222 | 3300009476 | Pelagic Marine | MYVLTIGSIVYLYDNEKDARKAFHQAVQKNNINNVKVVYNG* |
| Ga0115568_100030586 | 3300009498 | Pelagic Marine | MYVLTIGSIVYLYDNEKEARKAFHQSVVKNGINNVKVTYV* |
| Ga0115572_104950322 | 3300009507 | Pelagic Marine | MYVLTIGSIVYLYDNEKDARKAFHSAVQKNGINNVKVKYV* |
| Ga0115567_100263494 | 3300009508 | Pelagic Marine | MYILTIGSIVYMYDNEKEARKAFHQAVQKNNINNIKVVYNG* |
| Ga0098056_11726513 | 3300010150 | Marine | SIKGDCIMYVLTIGSIVYLYDNDKCARKAFHLAVQKNGINNVKVTYNG* |
| Ga0129351_10583102 | 3300010300 | Freshwater To Marine Saline Gradient | MYVLTIGTITYLYDNETDARKAFHESVVKNGINNVKVTYNG* |
| Ga0129351_10782063 | 3300010300 | Freshwater To Marine Saline Gradient | SGIIMYVLTIGSIVYLYDNEKDARKAFHQSVAKNGINNVKVTYV* |
| Ga0129351_12347372 | 3300010300 | Freshwater To Marine Saline Gradient | MYKVIIGDIVYLYDNVRAARKAFHIAVNKNGINNVKVTYVGG* |
| Ga0129352_107071002 | 3300012528 | Aqueous | MYVLTIGSIVYLYDNERDARKAFHQSVAKNGINNVKVTYV* |
| Ga0182083_10858892 | 3300016743 | Salt Marsh | MYKVIIGDIVYLYDNIKDAPKAFHIAVSKNGINNVKATYQSK |
| Ga0181387_10744103 | 3300017709 | Seawater | MYVLTIGSIVYLFDNDKDARKAFHQAVSKNGINNVKVTYND |
| Ga0181403_11119003 | 3300017710 | Seawater | IKGDWIMYVLTIGSIVYLYANAKDARKAFHQAVSKNGINNVKVTYND |
| Ga0181404_11827683 | 3300017717 | Seawater | GSIVYLFDNDKDARKAFHQAVSKNGINSVKVTYND |
| Ga0181383_11784233 | 3300017720 | Seawater | IMYTLTIGSIVYLFDNDKDARKAFHQAVSKNGINNVKVTYND |
| Ga0187218_11415703 | 3300017737 | Seawater | IKGDWIMYTLTIGSIVYLFDNDKDARKAFHQAVSKNGINNVKVTYND |
| Ga0181399_11685281 | 3300017742 | Seawater | IMYILTIGSIVYLFDNDKDARKAFHQAVSKNGINNVKVTYND |
| Ga0181408_11460081 | 3300017760 | Seawater | TIGSIVYLYDNEKDARKAYHHAVQKNGINNVKVTYND |
| Ga0181408_11635631 | 3300017760 | Seawater | PYPIKGDWIMYILTIGSIVYLFDNDKDARKAFHQAVSKNGINNVKVTYND |
| Ga0187217_10265545 | 3300017770 | Seawater | MYVLTIGSIVYLYDNEKDARKAYHESVAKNGINNVKVTYND |
| Ga0181424_100383031 | 3300017786 | Seawater | MYKVIIGDIVYLYDNEKDARKAFHIAVSKNGINNVQVSYE |
| Ga0181565_101279702 | 3300017818 | Salt Marsh | MSVYVLTIGDIVYYYDNVRAARKAFHQSVVKNGINNVKITKVVYGD |
| Ga0181552_100099011 | 3300017824 | Salt Marsh | MYKVIIGDIVYLYDNVRAARKAFHIAVNKNGINNVKVTYVGG |
| Ga0181552_100442653 | 3300017824 | Salt Marsh | MFKVIIGDIVYLYDNMKDARKAFHVAVSKNGINNVKVTYNG |
| Ga0181584_100195992 | 3300017949 | Salt Marsh | MYKVIIGDIVYLYDNIKDARKAFHIAVSKNGINNVKATYQSK |
| Ga0181607_106045292 | 3300017950 | Salt Marsh | MSVYVLTIGDIVYYYDNVRAARKAFHQSVVKNGINNVKITKVVNGD |
| Ga0181577_102479162 | 3300017951 | Salt Marsh | MFKVIIGDIVYLYDNMKDARKAFHIAVSKNGINNVKVTYNG |
| Ga0181592_103786092 | 3300018421 | Salt Marsh | MPIVNKEGENMYKVIIGDIVYLYDNMKDARKAFHIAVTKNGINNVKVMYV |
| Ga0181591_102001771 | 3300018424 | Salt Marsh | MFKVIIGDIVYLYDNIKDARKAFHVAVSKNGINNVKVTYNG |
| Ga0181566_106174512 | 3300018426 | Salt Marsh | MFKVIIGDIVYLYDNMKDARKAFHVAVSKNGINNVK |
| Ga0181603_103486102 | 3300020174 | Salt Marsh | MSVYVLTIGDIVYYYDNVRAARKAFHQSVVKNGINNVKITKVVYGN |
| Ga0206124_100167536 | 3300020175 | Seawater | MYVLTIGSIVYLYDNEKDARKAFHQSVVKNGINNVKVKYV |
| Ga0206124_100939334 | 3300020175 | Seawater | MYILTIGSIVYMYDNEKEARKAFHQAVQKNNINNVKVVYNG |
| Ga0206124_102347343 | 3300020175 | Seawater | MYVLTIGSIVYLYDNEKDARKAFHQAVQKNNINNVKVKYV |
| Ga0181556_13126852 | 3300020176 | Salt Marsh | GDIMYILTIGTIVYYYDNVTDARKAFHQSVAKNGINNVKITKV |
| Ga0211576_104670323 | 3300020438 | Marine | MYILTIGSIVYLFDNDKDARKAFHQAVSKNGINNVKVTYND |
| Ga0211577_108406083 | 3300020469 | Marine | DWIMYTLTIGSIVYLFDNDKDARKAFHQAVSKNGINNVKVTYND |
| Ga0206677_100045877 | 3300021085 | Seawater | MYVLTIGSIVYLYDNDKDARKAYHHAVQKNGINNVKVTYND |
| Ga0213867_12564171 | 3300021335 | Seawater | MYKVIIGDIVYLYDNVKAARKAFHIAVNKNGINNVKVTYVGG |
| Ga0213862_101470333 | 3300021347 | Seawater | MYKVIIGNIVYLYDNIKAARKAFHVAVSKNGINNVKVTYHD |
| Ga0213859_100514323 | 3300021364 | Seawater | MYKVIIGDIVYLYDNMKDARKAFHIAVTKNGINNVKVMYV |
| Ga0213869_1000276418 | 3300021375 | Seawater | RSGIIMYVLTIGTITYLYDNEKDARKAFHQSVAKNGINNVKVNYV |
| Ga0213869_100166115 | 3300021375 | Seawater | MYVLTIGTTTYLYDNETDARKAFHESVVKNGINNVKVTYNG |
| Ga0213868_102537913 | 3300021389 | Seawater | MYVLTIGTTTYLYDNEKDARKAFHQSVAKNGINNVKVTYV |
| Ga0222718_103897161 | 3300021958 | Estuarine Water | MYKVIIGDIVYLYDNVKEARKAFHIAVSKNGINNVKVTYHGE |
| Ga0222719_105778133 | 3300021964 | Estuarine Water | MYTLTIGSIVYLFDNDKDARKAFHQAVSKNGINNVKVTYND |
| Ga0224906_11278131 | 3300022074 | Seawater | MNYYKLMIGSIVYIYDNVRDARKAFHIAVSKNGINNVSITK |
| Ga0196891_10792412 | 3300022183 | Aqueous | MYVLTIGTIVYLYDNEKDARKAFHQSVATNGINNVKVTYV |
| Ga0255771_11127402 | 3300022900 | Salt Marsh | MFKVIIGDIVYLYDNMKDARKAFHVAVSKNGINNVKVT |
| Ga0255755_13220832 | 3300022909 | Salt Marsh | MYKVIIGDIVYLYDNVRAARKAFHIAVNKNGINNVKV |
| Ga0255777_103568652 | 3300023175 | Salt Marsh | GDIVYLYDNIKDARKAFHIAVSKNGINNVKATYQSK |
| Ga0232122_10704742 | 3300023709 | Salt Marsh | MFKVIIGDIVYLYDNMKDARKAFHIAVSTNGINNVKVTYNG |
| Ga0244775_100087915 | 3300024346 | Estuarine | MYVLTIGTITYLYDNEKEARKAFHQSVAKNGINNVKVTYV |
| Ga0208149_10745482 | 3300025610 | Aqueous | MYVLTIGSIVYLYDNEKDARKAFHQSVATNGINNVKVTYV |
| Ga0208428_100081617 | 3300025653 | Aqueous | MYVLTIGSIVYLYDNEKDARKAFHQSVAKNGINNVKVTYV |
| Ga0208162_11894422 | 3300025674 | Aqueous | MYVLTIGTIVYLYDNEKEARKAFHQSVATNGINNVKVTYV |
| Ga0209306_12228752 | 3300025680 | Pelagic Marine | MYVLTIGSIVYLYDNEKDARKAFHQSVAKNGINNVKVKYV |
| Ga0209305_10788313 | 3300025712 | Pelagic Marine | INGIDYLYDNEKDARKAFHESVAKNGLDNVKITKETL |
| Ga0208427_12203101 | 3300025771 | Aqueous | IGSIVYLYDNEKDARKAFHQSVATNGINNVKVTYV |
| Ga0208543_10396152 | 3300025810 | Aqueous | MYVLTIGTITYLYDNEKDARKAFHQSVAKNGINNVKVTYV |
| Ga0209193_10951602 | 3300025816 | Pelagic Marine | MYVLTIGSIVYLYDNEKDARKAFHQSVVKNGINNVKVTYV |
| Ga0209832_10594101 | 3300025830 | Pelagic Marine | IGSIVYLYDNEKDARKAYHQSVAKNGINNVKVKYV |
| Ga0209603_10255762 | 3300025849 | Pelagic Marine | MYVLTIGSIVYLYDNEKDARKAFHSAVQKNGINNVKVKYV |
| Ga0208763_10335962 | 3300026136 | Marine | MYKVIIGNIVYLYDNEKDARKAYHVAVEKNGINNVEVSYE |
| Ga0208897_11409801 | 3300027571 | Estuarine | IIMYVLTIGTITYLYDNEKEARKAFHQSVAKNGINNVKVTYV |
| ⦗Top⦘ |