NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105189

Metagenome / Metatranscriptome Family F105189

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105189
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 49 residues
Representative Sequence MAGIPKIKITFDADFDELKKGVKGAQNEVEGFGSKVGDFAKKAGAAFALA
Number of Associated Samples 81
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 71.67 %
% of genes near scaffold ends (potentially truncated) 58.00 %
% of genes from short scaffolds (< 2000 bps) 57.00 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (55.000 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(46.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(41.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.72%    β-sheet: 0.00%    Coil/Unstructured: 51.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF05065Phage_capsid 2.00
PF03354TerL_ATPase 1.00
PF04586Peptidase_S78 1.00
PF04860Phage_portal 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 2.00
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 1.00
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.00 %
UnclassifiedrootN/A40.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000756|JGI12421J11937_10076027All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage987Open in IMG/M
3300004282|Ga0066599_100172534All Organisms → Viruses → Predicted Viral1142Open in IMG/M
3300005582|Ga0049080_10239881All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage593Open in IMG/M
3300006484|Ga0070744_10002938All Organisms → cellular organisms → Bacteria5139Open in IMG/M
3300006802|Ga0070749_10467911All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage689Open in IMG/M
3300006802|Ga0070749_10798256All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300006803|Ga0075467_10536736All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage600Open in IMG/M
3300006805|Ga0075464_10643052All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage654Open in IMG/M
3300007708|Ga0102859_1054433All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1113Open in IMG/M
3300008107|Ga0114340_1214149All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage629Open in IMG/M
3300008450|Ga0114880_1242684All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage568Open in IMG/M
3300009082|Ga0105099_10432565All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage789Open in IMG/M
3300009085|Ga0105103_10234244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage989Open in IMG/M
3300009157|Ga0105092_10887421All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300009170|Ga0105096_10768845All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage514Open in IMG/M
3300009181|Ga0114969_10306358All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage935Open in IMG/M
3300009181|Ga0114969_10771142All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage512Open in IMG/M
3300010885|Ga0133913_12292804All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1326Open in IMG/M
3300012709|Ga0157608_1015108All Organisms → Viruses → Predicted Viral1999Open in IMG/M
3300017723|Ga0181362_1005697All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2646Open in IMG/M
3300017761|Ga0181356_1207145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300021963|Ga0222712_10015561All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6579Open in IMG/M
3300024509|Ga0255175_1045944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage826Open in IMG/M
3300025896|Ga0208916_10188712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage891Open in IMG/M
3300026459|Ga0255170_1062597All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300027721|Ga0209492_1279768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300027732|Ga0209442_1061034All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1599Open in IMG/M
3300027754|Ga0209596_1155246All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1014Open in IMG/M
3300027772|Ga0209768_10418573All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300027785|Ga0209246_10275114All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300027792|Ga0209287_10383607All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage540Open in IMG/M
3300027798|Ga0209353_10261476All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage742Open in IMG/M
3300027798|Ga0209353_10369599All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage595Open in IMG/M
3300027805|Ga0209229_10194721All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage908Open in IMG/M
3300027808|Ga0209354_10116879All Organisms → Viruses → Predicted Viral1089Open in IMG/M
3300027892|Ga0209550_10677915All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage596Open in IMG/M
3300027900|Ga0209253_10782979All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage680Open in IMG/M
3300027971|Ga0209401_1118432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1070Open in IMG/M
3300028091|Ga0255184_1103260All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage526Open in IMG/M
3300031673|Ga0307377_11065546All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage538Open in IMG/M
3300031707|Ga0315291_10940421All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage734Open in IMG/M
3300031857|Ga0315909_10962859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300031885|Ga0315285_10951756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300031952|Ga0315294_10971754All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage711Open in IMG/M
3300031963|Ga0315901_11208783All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage511Open in IMG/M
3300031999|Ga0315274_10575455All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1251Open in IMG/M
3300031999|Ga0315274_10775064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1022Open in IMG/M
3300032046|Ga0315289_10868378All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage781Open in IMG/M
3300032053|Ga0315284_11984514All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300032156|Ga0315295_10610850All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1104Open in IMG/M
3300032342|Ga0315286_10899823All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage888Open in IMG/M
3300032516|Ga0315273_11740272All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage753Open in IMG/M
3300033993|Ga0334994_0552086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300034012|Ga0334986_0104386All Organisms → Viruses → Predicted Viral1694Open in IMG/M
3300034062|Ga0334995_0710274All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300034068|Ga0334990_0576679All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage593Open in IMG/M
3300034102|Ga0335029_0779430All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300034104|Ga0335031_0788611All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300034106|Ga0335036_0395960All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage889Open in IMG/M
3300034272|Ga0335049_0801744All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater20.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake15.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment12.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater8.00%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment6.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.00%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater5.00%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment3.00%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.00%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.00%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.00%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment1.00%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater1.00%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.00%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.00%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.00%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000756Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300012709Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300024505Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300024509Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8dEnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026459Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300026473Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8dEnvironmentalOpen in IMG/M
3300027563Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027971Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028091Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034068Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034120Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034284Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12421J11937_1007602713300000756Freshwater And SedimentMASIPKVKITFDADFDDLKKGIKGGQAEVESFADKVGDFGKKAAAAFAV
Ga0066599_10017253433300004282FreshwaterMAGIPKVKITFDADFDELKKGVKGAQGQVEGFSDKIGKFGKVAAAAFAAATV
Ga0069718_1608977913300004481SedimentMAIPKVKITFDADLDGLRKGVNGASSEVEGFGGKVAKFGKMAGAAFAA
Ga0049080_1023988123300005582Freshwater LenticMAGIPKVKITFDADFDELKRGVKGAEQEVQGFGDKM
Ga0070744_1000293813300006484EstuarineMAGIPKVKITFDADFDDLKKGISGAQNEVEGFGSKVSAFGKKAAAGFALAAAAAVAY
Ga0070749_1046791113300006802AqueousMAGIPKVKITFDADFDELKRGVKGATDEVEGFGTKIGKFGKAAGAAFAVAGAAA
Ga0070749_1079825623300006802AqueousMAGIPKVKITFDADFDELKRGVKGAEQEVQGFGDK
Ga0075467_1053673613300006803AqueousMAGIPKVKITFDADFDELKRGVAGAQNEVQSFGDKMGKFGKMAGAAFAVASAAAL
Ga0075464_1064305223300006805AqueousMAIPKVKITFDADLDGLRKGVNGASNEVQGFGDKDA*
Ga0075458_1002023313300007363AqueousMAGIPKVKIQFDADLDGLKKGTSDADKEVGGFADRVGEFGKK
Ga0102859_105443333300007708EstuarineMAGIPKVKITFDADFDDLKKGIKGSQAEVETFADKVGDFGKKAAVAFGIAGVAIGAFALAADKAAAED*
Ga0114340_121414923300008107Freshwater, PlanktonMAGIPKVKITFDADLDELKKGVKSATSEVQSFGDRAADFGKKAALAFAVAGAAVTAF
Ga0114363_109419013300008266Freshwater, PlanktonMAIPKVKITFDADLDGLRKGVNGASNEVEGFGSKVAKFGKMAGAAFAAAGVAAAAY
Ga0114363_109979733300008266Freshwater, PlanktonMAIPKVKISFDADLDGLRKGVNGASDEVEGFGAKVGKFGKMA
Ga0114880_110447133300008450Freshwater LakeMAGIPKIKITFDADFDQLKAGVKGAQNEVEGFGSKMGGFAKKAG
Ga0114880_124268413300008450Freshwater LakeMAIPKVKITFDADLDGLRKGVNGASNEVEGFGSKVSKFGKMAGAAFAAAG
Ga0105099_1043256513300009082Freshwater SedimentMAGIPKVKITFDADFDDLKKGISGAQTEVSGFSDKLGKFAK
Ga0105103_1023424433300009085Freshwater SedimentMAGIPKVKITFDADFDELKKGVKGAQNEVEGFSSKIGKFGKVAAAAFAAA
Ga0105092_1088742123300009157Freshwater SedimentMAGIPKIKITFDADFDQLKSGVKGAQNEVEGFGSKLGGFAKKAGKAFAVAGAAAAAYAGVLLVDGV
Ga0105096_1076884523300009170Freshwater SedimentMAGISKIKITFDADFDELKKGVKGAQNEVEGFGSKLGGFAKKAGK
Ga0114969_1030635833300009181Freshwater LakeMAGIPKVKITFDADFDELKRGVTGATNEVQSFGDKMG
Ga0114969_1058600723300009181Freshwater LakeMAGIPKVKIQFDADFDDLKKGVKGATDEIEGFGSRVGDFAKKAGVAFAIAGAAAAAYAG
Ga0114969_1077114213300009181Freshwater LakeMAGIPKVKITFYADFDELKKGIKGGQDEIETFGSKVGDFGKKAGLAFAAAGIAAAAYASKLLIDGVKSAIADE
Ga0129333_1096288213300010354Freshwater To Marine Saline GradientMAGIPKVKIQFDADLDGLKKGSKDAEDQVEGFAGKVGEF
Ga0133913_1229280413300010885Freshwater LakeMAGIPKVKITFDADFDDLKKGIKGSQAEVETFSDKVGDFGQKAAIAFAAAG
Ga0157210_103633613300012665FreshwaterMAGIPKVKITFDADFDELKRGVKGAEQEVQSFGDKMGKFGKMAGAAFAVA
Ga0157608_101510863300012709FreshwaterMAGIPKIKITFDADFDELKKGVKGAQNEVEGFGSKMGGFAKKAGAAFAV
Ga0129338_137035823300012970AqueousMAGIPKVKIQFDADLDGLKKGSKDAEDQVEGFAGKVGEFGKKAAA
Ga0181362_100569773300017723Freshwater LakeMAGIPKVKITFDADFDELKKGIAGGQKEIESFGSRVSDFGKKAGLAFAVAGAA
Ga0181365_100149093300017736Freshwater LakeMAGIPKVKITFDADFDELKRGVKGAEAEVQGFGDKV
Ga0181365_106116533300017736Freshwater LakeMAGIPKVKITFDADFDDLKKGIKGGQAEVEGFSSKVGE
Ga0181356_120714523300017761Freshwater LakeMAGIPKVKITFDADFDELKKGIAGGQKEIESFGSRVSDFGKKAGLAFAVAGAAAAAYAGKLLIDGV
Ga0181357_111680533300017777Freshwater LakeMAGIPKVKITFDADFDDLKKGIRGGQAEVETFASKVGDFGKKAAV
Ga0181355_119859613300017785Freshwater LakeMAGIPKVKIQFDADLDGLKKGSKDAEDQVEGFAGKVGEFGKKAAAA
Ga0211734_1021587023300020159FreshwaterMAGIPKIKITFDADFDELRRGVKGATDEVEGFGDRAKKFGKVAGLAFAAAGAAAVA
Ga0222712_1001556113300021963Estuarine WaterMAGIPKVKIQFDADFSDLQKGLKSTEGEIEGFGSKVGDFGKKAGVAFGVAAVAAAAYATTLLIDGVQS
Ga0255150_101614513300024505FreshwaterMAGIPKVKITFDADFDELKRGVKGAENEVTSFGDRM
Ga0255175_104594433300024509FreshwaterMAGIPKVKITFDADFDELKRGITGATNEVEGFGSKMGKFGKIAGAAFAAAGAAALAYAGVLLKQGVES
Ga0208147_101484413300025635AqueousMAGIPKVKIQFDADLDGLKKGTSDADKEVGGFADRVGEFGKKA
Ga0208916_1018871213300025896AqueousMAGIPKVKITFDADFDELKRGVAGAQNEVQNFGDKMGKFGKMAGAAFAVASAAALAYAGVLLKQGV
Ga0255170_106259723300026459FreshwaterMAGIPKVKITFDADFDELKRGITGATNEVEGFGSK
Ga0255166_102901833300026473FreshwaterMAGIPKVKITFDADFDELKRGVKGAENEVTSFGDRMSKFGKIAGAAFAAAGAAAIAYGAVLLKQ
Ga0209552_103584843300027563Freshwater LakeMAGIPKVKITFDADFDDLKKGIKGGQAEVEGFGAK
Ga0209492_127976813300027721Freshwater SedimentMAGIPKIKISFDADFDELKKGVKGAQNEVQGFGSKMGDFAKKAGKAFAVAGAAAAAYAGVLLVDGVKSAIEDE
Ga0209442_106103443300027732Freshwater LakeMAGIPKVKITFDADFDELKRGVKGAEAEVQGFGDKVGKFGKMAGAAFAVAGAAALAYGAVLLKQGVESAIA
Ga0209596_115524633300027754Freshwater LakeMAGIPKVKITFDADFDELKRGVAGAENEVQSFGDKMGKFGKMAGAAFA
Ga0209768_1041857323300027772Freshwater LakeMAGIPKVKITFDADFDELKRGVKGAEAEVQGFGDKVGKFGKMAGA
Ga0209246_1027511423300027785Freshwater LakeMAGIPKVKITFDADFDELKKGIKGGQNEIESFGSKVGDFGKKAGLAFA
Ga0209287_1038360723300027792Freshwater SedimentMAGIPKVKITFDADFDELKRGVKGAQTEVEGFSDKIGKFGKV
Ga0209353_1026147623300027798Freshwater LakeMAGIPKVKITFDADFDDLKKGIRGGQAEVETFASKVGDFGKKA
Ga0209353_1036959913300027798Freshwater LakeMAGIPKVKITFDADFDDLKKGIKGGQGEIESFSDKVTDFGKKAGLA
Ga0209353_1044608213300027798Freshwater LakeMAGIPKVKITFDADFDDLKKGIKGSQAEVETFADKVGDFGKKAAIAFGIAG
Ga0209229_1019472133300027805Freshwater And SedimentMAGIPKIKITFDADFDELKKGVKGAQNEVEGFGSKMGDFAK
Ga0209354_1011687933300027808Freshwater LakeMAGIPKIKITFDADFDELKKGVKGAQNEVQGFGSKVG
Ga0209550_1067791523300027892Freshwater LakeMAGIPKIKITFDADFDELKKGVKGAQNEVEGFGSKVGDFAKKAGAAFALA
Ga0209253_1049162433300027900Freshwater Lake SedimentMAGIPKIKITFDADFDELKKGVKGAQNEVEGFGSK
Ga0209253_1078297923300027900Freshwater Lake SedimentMAGIPKIKITFDADFDELKKGVKGAQNEVEGFGSKVGDFA
Ga0209253_1088639113300027900Freshwater Lake SedimentMAIPKVKITFDADLDGLRKGVNGASSEVEGFGGKVAKFGKMA
Ga0209401_111843213300027971Freshwater LakeMAGIPKVKITFDADFDELKRGVKGAEQEVQGFGDKMGKFGKMAGAAFAIAGAAALAYAGVLLKQGVE
Ga0255184_110326013300028091FreshwaterMAGIPKVKITFDADFDELKRGVKGAENEVTSFGDRMSKFGKIAGAAFAAAGAAAIAYGAVLL
Ga0307377_1106554623300031673SoilMAGIPKVRVQFDADFDQLKKGVKGATNEVESFGSKVGDFSKKAGQAFALVGA
Ga0315291_1094042123300031707SedimentMAGIPKVKITFDADFDDLKKGIKGGQDEVEGFSSKVGEFGKKAAA
Ga0315900_1068562913300031787FreshwaterMAIPKVKITFDADLDGLRKGVNGASNEVQGFGDRVAKFGKMAGAAFAAAGV
Ga0315909_1035078533300031857FreshwaterMAGIPKVKIQFDADLDGLKKGTASADKEVAGFADKVGEFGKKAAAAFAVAAAA
Ga0315909_1096285913300031857FreshwaterMAGIPKIKITFDADFDQLKAGVKGAQNEVEGFGSKMGGFAKKAGAAFA
Ga0315285_1095175623300031885SedimentMAGIPKVKITFDADFDELKKGIKGGQNEIESFGSKVGDFGKKAGLAFAAAGIAAAAYASKLLIDGVKSAIADE
Ga0315904_1070888213300031951FreshwaterMAIPKVKITFDADLDGLKKGTKGAEDELTGFSGKVAEFGKKAAAAFA
Ga0315294_1097175423300031952SedimentMAGIPKVKITFDADFDDLKKGIKGGQAEVESFADKVGDFGKKAAAAFAVA
Ga0315901_1010855663300031963FreshwaterMAGIPKVKIQFDADLDGLKKGSKDAEDQVDGFAGKVSEFGKKAAAAFAVAAAAKPST
Ga0315901_1120878323300031963FreshwaterMAIPKVKITFDADLDGLRRGVNGASNEVQGFGDRV
Ga0315274_1057545543300031999SedimentMAGIPKVKITFDADFDDLKKGIKGGQDEIEGFGSKVGEFGKKAAVAFAVA
Ga0315274_1077506433300031999SedimentMAGIPKVKITFDADFDDLKKGIKGGQGEIESFSDKVTEFGKKA
Ga0315289_1048354513300032046SedimentMAGIPKVRVQFDADFDELKKGVRGATNEVEGFGSKVGDFAKKAGAAFAIAGVAAAVYAGKLL
Ga0315289_1086837833300032046SedimentMAGIPKVKITFDADFDELKKGVKGATDEVEGFGGKIADFGKKAAVA
Ga0315906_1084238123300032050FreshwaterMAGIPKVKIQFDADLDGLKKGTASADKEVAGFADKVGEFGK
Ga0315284_1198451423300032053SedimentMAGIPKVKITFDADFDDLKKGISGAQNEVEGFGSK
Ga0315903_1006385973300032116FreshwaterMAGIPKVKITFDADFDELKRGVKGATDEVEGFGSKVGKFGKAAG
Ga0315277_1165816713300032118SedimentMAGIPKVKITFDADFDELKKGIKGGQNEIESFGSKVGDFGKKAGLAFAAAGIAAAAYASKLL
Ga0315295_1061085033300032156SedimentMAGIPKVKITFDADFDDLKKGIKGGQDEVEGFSSKVGEFGKKAAAAFALAAA
Ga0315286_1089982333300032342SedimentMAGIPKVKITFDADFDDLKKGIKGGQDEIEGFGSKVGEF
Ga0315273_1174027213300032516SedimentMAGIPKVKITFDADFDDLKKGIKGGQAEVESFADKVGDFGKKAAAAFAVAAVAA
Ga0334992_0429256_2_1723300033992FreshwaterMAGIPKVKITFDADFDDLKKGIKGSQAEVETFADKVGDFGKKAAVAFGIAGAAIGAF
Ga0334994_0552086_401_5233300033993FreshwaterMAGIPKVKITFDADFDELKKGVKGAQKEVEGFSDKIGKFGK
Ga0334986_0104386_1523_16933300034012FreshwaterMAGIPKVKITFDADFDELKKGVKGAQNEVEGFSDRIGKFGKVAAAAFAAATVAAVAY
Ga0334987_0133382_1_1653300034061FreshwaterMAGIPKVKITFDADLDGLRKGVNGASTEVSGFGDKVKKFGKMAAAAFAAAGVAAL
Ga0334987_0659366_1_1533300034061FreshwaterMAGIPKVKITFDADFDDLKKGIKGSQAEIETFSDKVGDFGKKAAVAFGVAA
Ga0334995_0279220_2_1063300034062FreshwaterMAIPKVKITFDADLDGLRRGVNGASNEVSGFGDKV
Ga0334995_0710274_1_1593300034062FreshwaterMAGIPKIKITFDADFDELKKGVKGAQNEVEGFGSKVGDFAKKAGAAFALAGAA
Ga0334990_0576679_3_1553300034068FreshwaterMAGIPKIKITFDADFDELKKGVKGAQNEVEGFGSKVGDFAKKAGAAFALAG
Ga0335010_0235781_1_1623300034092FreshwaterMAGIPKVKITFDADFDELKKGVKGAQNEVEGFSSKIGKFGKVAAAAFAAATVAA
Ga0335010_0659241_355_5193300034092FreshwaterMAGIPKVKITFDADFDDLKKGIKGSQAEVETFADKVGDFGKKAAVAFGIAGAAIG
Ga0335029_0269941_1_1623300034102FreshwaterMAGIPKVKIQFDADLDGLKKGTQDADQEIGGFAGKVEEFGKRAAAAFALAAAAA
Ga0335029_0779430_2_1363300034102FreshwaterMAGIPKVKITFDADLDELKKGVKSATGEVQSFSDRAADFGKKAAL
Ga0335031_0038762_2_1153300034104FreshwaterMAGIPKVKITFDADFDELKKGVKGAQNEVEGFSSKIGK
Ga0335031_0788611_388_5313300034104FreshwaterMAGIPKVKITFDADFDELRKGVKGAEKEVEGFGSKVADFGKKMAAAFA
Ga0335036_0395960_683_8893300034106FreshwaterMAIPKVKITFDADLDGLRRGVNGASNEVQGFGDRVAKFGKMAGAAFAAAGVAATAYAGKLLVDGVKSAI
Ga0335053_0117092_1684_18273300034118FreshwaterMAGIPKVKITFDADFDELKRGVKGAENEVKGFGDKMGKFGKIAGTAFA
Ga0335056_0046113_2_1633300034120FreshwaterMAIPKVKITFDADLDGLRKGVNGASNEVQGFGDRVAKFGKMAGAAFAAAGVAAA
Ga0335049_0801744_3_1703300034272FreshwaterMAGIPKVKITFDADFDELKRGVKGATDEVEGFGSKVGKFGKAAGAAFAVAGAAALA
Ga0335013_0603199_507_6413300034284FreshwaterMAIPKVKITFDADLDGLRKGTKGASDEVEGFGAKLGKFGKIAGAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.