 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F105180 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSYLILFTTGLLIGFVAGLLVYRKHSDRLKSTEDKGKSILDALKGR |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 21.00 % |
| % of genes from short scaffolds (< 2000 bps) | 64.00 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (15.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (41.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.11% β-sheet: 0.00% Coil/Unstructured: 41.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01464 | SLT | 5.00 |
| PF05876 | GpA_ATPase | 3.00 |
| PF13481 | AAA_25 | 1.00 |
| PF01343 | Peptidase_S49 | 1.00 |
| PF13444 | Acetyltransf_5 | 1.00 |
| PF04404 | ERF | 1.00 |
| PF12684 | DUF3799 | 1.00 |
| PF04275 | P-mevalo_kinase | 1.00 |
| PF11651 | P22_CoatProtein | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG5525 | Phage terminase, large subunit GpA | Mobilome: prophages, transposons [X] | 3.00 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 2.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.00 % |
| All Organisms | root | All Organisms | 34.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10000292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 19020 | Open in IMG/M |
| 3300000756|JGI12421J11937_10047625 | Not Available | 1413 | Open in IMG/M |
| 3300000882|FwDRAFT_10044720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3828 | Open in IMG/M |
| 3300003277|JGI25908J49247_10002486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5878 | Open in IMG/M |
| 3300003277|JGI25908J49247_10027533 | Not Available | 1634 | Open in IMG/M |
| 3300003394|JGI25907J50239_1059976 | Not Available | 763 | Open in IMG/M |
| 3300005580|Ga0049083_10046302 | Not Available | 1540 | Open in IMG/M |
| 3300005581|Ga0049081_10002158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7408 | Open in IMG/M |
| 3300005581|Ga0049081_10031206 | Not Available | 2025 | Open in IMG/M |
| 3300005584|Ga0049082_10281186 | Not Available | 558 | Open in IMG/M |
| 3300006484|Ga0070744_10028147 | Not Available | 1665 | Open in IMG/M |
| 3300006805|Ga0075464_10195060 | Not Available | 1202 | Open in IMG/M |
| 3300006805|Ga0075464_10639474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300007544|Ga0102861_1014012 | All Organisms → Viruses → Predicted Viral | 1950 | Open in IMG/M |
| 3300007544|Ga0102861_1019185 | Not Available | 1690 | Open in IMG/M |
| 3300007544|Ga0102861_1099067 | Not Available | 778 | Open in IMG/M |
| 3300007545|Ga0102873_1000144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28213 | Open in IMG/M |
| 3300007600|Ga0102920_1006089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3376 | Open in IMG/M |
| 3300007670|Ga0102862_1208151 | Not Available | 508 | Open in IMG/M |
| 3300007972|Ga0105745_1095048 | Not Available | 871 | Open in IMG/M |
| 3300007974|Ga0105747_1117427 | Not Available | 841 | Open in IMG/M |
| 3300007974|Ga0105747_1232592 | Not Available | 613 | Open in IMG/M |
| 3300008055|Ga0108970_11290904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2723 | Open in IMG/M |
| 3300008267|Ga0114364_1014667 | Not Available | 8166 | Open in IMG/M |
| 3300008267|Ga0114364_1014671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3440 | Open in IMG/M |
| 3300008267|Ga0114364_1016952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5552 | Open in IMG/M |
| 3300008267|Ga0114364_1036279 | Not Available | 1880 | Open in IMG/M |
| 3300008267|Ga0114364_1063003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → Methylotenera oryzisoli | 1278 | Open in IMG/M |
| 3300008450|Ga0114880_1129733 | Not Available | 935 | Open in IMG/M |
| 3300008450|Ga0114880_1135105 | Not Available | 908 | Open in IMG/M |
| 3300008996|Ga0102831_1011460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3117 | Open in IMG/M |
| 3300008999|Ga0102816_1313185 | Not Available | 501 | Open in IMG/M |
| 3300009051|Ga0102864_1048851 | Not Available | 1144 | Open in IMG/M |
| 3300009057|Ga0102892_1037053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
| 3300009068|Ga0114973_10338400 | Not Available | 796 | Open in IMG/M |
| 3300009152|Ga0114980_10002043 | Not Available | 14398 | Open in IMG/M |
| 3300009155|Ga0114968_10141466 | Not Available | 1434 | Open in IMG/M |
| 3300009181|Ga0114969_10743247 | Not Available | 525 | Open in IMG/M |
| 3300009183|Ga0114974_10039394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3218 | Open in IMG/M |
| 3300009419|Ga0114982_1004012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5905 | Open in IMG/M |
| 3300010388|Ga0136551_1037526 | Not Available | 901 | Open in IMG/M |
| 3300010885|Ga0133913_10655636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2751 | Open in IMG/M |
| 3300010885|Ga0133913_11363374 | Not Available | 1807 | Open in IMG/M |
| 3300010885|Ga0133913_12125210 | Not Available | 1388 | Open in IMG/M |
| 3300011337|Ga0153702_1396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15069 | Open in IMG/M |
| 3300012012|Ga0153799_1025734 | Not Available | 1155 | Open in IMG/M |
| 3300012012|Ga0153799_1073338 | Not Available | 617 | Open in IMG/M |
| 3300012665|Ga0157210_1000365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20431 | Open in IMG/M |
| 3300012665|Ga0157210_1033439 | Not Available | 802 | Open in IMG/M |
| 3300012666|Ga0157498_1015713 | Not Available | 1189 | Open in IMG/M |
| 3300013372|Ga0177922_10084727 | Not Available | 969 | Open in IMG/M |
| 3300013372|Ga0177922_10484930 | Not Available | 760 | Open in IMG/M |
| 3300017780|Ga0181346_1277351 | Not Available | 576 | Open in IMG/M |
| 3300017784|Ga0181348_1059075 | Not Available | 1555 | Open in IMG/M |
| 3300019784|Ga0181359_1011383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3195 | Open in IMG/M |
| 3300019784|Ga0181359_1034853 | Not Available | 1948 | Open in IMG/M |
| 3300019784|Ga0181359_1055503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1524 | Open in IMG/M |
| 3300020151|Ga0211736_10000125 | Not Available | 2336 | Open in IMG/M |
| 3300020151|Ga0211736_10530327 | Not Available | 698 | Open in IMG/M |
| 3300020159|Ga0211734_10013582 | Not Available | 509 | Open in IMG/M |
| 3300020172|Ga0211729_10213555 | Not Available | 2619 | Open in IMG/M |
| 3300020205|Ga0211731_10485154 | All Organisms → Viruses → Predicted Viral | 2847 | Open in IMG/M |
| 3300021519|Ga0194048_10173731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300021963|Ga0222712_10008525 | All Organisms → cellular organisms → Bacteria | 9666 | Open in IMG/M |
| 3300022190|Ga0181354_1076057 | Not Available | 1111 | Open in IMG/M |
| 3300024343|Ga0244777_10000395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34563 | Open in IMG/M |
| 3300024346|Ga0244775_10154252 | Not Available | 1938 | Open in IMG/M |
| 3300024346|Ga0244775_10363014 | Not Available | 1194 | Open in IMG/M |
| 3300025763|Ga0255250_1081676 | Not Available | 703 | Open in IMG/M |
| 3300026429|Ga0255253_1043070 | Not Available | 728 | Open in IMG/M |
| 3300026454|Ga0256319_1042292 | Not Available | 899 | Open in IMG/M |
| 3300027205|Ga0208926_1003851 | Not Available | 2189 | Open in IMG/M |
| 3300027205|Ga0208926_1069022 | Not Available | 515 | Open in IMG/M |
| 3300027224|Ga0208164_1087615 | Not Available | 528 | Open in IMG/M |
| 3300027259|Ga0208178_1100044 | Not Available | 510 | Open in IMG/M |
| 3300027608|Ga0208974_1000812 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12507 | Open in IMG/M |
| 3300027608|Ga0208974_1011437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2876 | Open in IMG/M |
| 3300027608|Ga0208974_1153869 | Not Available | 581 | Open in IMG/M |
| 3300027608|Ga0208974_1163181 | Not Available | 558 | Open in IMG/M |
| 3300027631|Ga0208133_1018121 | Not Available | 1834 | Open in IMG/M |
| 3300027659|Ga0208975_1001615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9358 | Open in IMG/M |
| 3300027697|Ga0209033_1059701 | Not Available | 1342 | Open in IMG/M |
| 3300027710|Ga0209599_10000378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 29785 | Open in IMG/M |
| 3300027732|Ga0209442_1144343 | Not Available | 922 | Open in IMG/M |
| 3300027732|Ga0209442_1173594 | Not Available | 814 | Open in IMG/M |
| 3300027733|Ga0209297_1003377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8535 | Open in IMG/M |
| 3300027797|Ga0209107_10003102 | Not Available | 9192 | Open in IMG/M |
| 3300027797|Ga0209107_10015957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4285 | Open in IMG/M |
| 3300027900|Ga0209253_10059890 | Not Available | 3150 | Open in IMG/M |
| 3300028025|Ga0247723_1008221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4338 | Open in IMG/M |
| 3300028025|Ga0247723_1008913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4073 | Open in IMG/M |
| 3300031707|Ga0315291_10783436 | Not Available | 833 | Open in IMG/M |
| 3300031873|Ga0315297_11719335 | Not Available | 502 | Open in IMG/M |
| 3300031885|Ga0315285_10108427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2404 | Open in IMG/M |
| 3300031997|Ga0315278_11793277 | Not Available | 580 | Open in IMG/M |
| 3300032053|Ga0315284_10711521 | Not Available | 1178 | Open in IMG/M |
| 3300033996|Ga0334979_0220159 | Not Available | 1110 | Open in IMG/M |
| 3300034102|Ga0335029_0165958 | Not Available | 1498 | Open in IMG/M |
| 3300034105|Ga0335035_0479995 | Not Available | 685 | Open in IMG/M |
| 3300034110|Ga0335055_0070008 | Not Available | 1613 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 15.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.00% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 9.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.00% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.00% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 4.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.00% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 3.00% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.00% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 3.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.00% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.00% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.00% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.00% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.00% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 1.00% |
| Freshwater And Marine | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine | 1.00% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 1.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.00% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300000882 | Freshwater microbial communities from the Columbia River | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009057 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011337 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025763 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026429 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026454 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027224 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027259 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_100002926 | 3300000756 | Freshwater And Sediment | MSYIFTFLTGLLIGVLGGILVYRKNGDRLKETEAKGKSILDAIRGK* |
| JGI12421J11937_100476252 | 3300000756 | Freshwater And Sediment | MSYLILFLTGLLIGFVAGLLVYRRHSDRLKSTETKGKNLLDALKGK* |
| FwDRAFT_100447202 | 3300000882 | Freshwater And Marine | MSYLILFTTGLLIGVVAGILVYRKNGDRLKETETKGKNLLDALKGK* |
| JGI25908J49247_1000248611 | 3300003277 | Freshwater Lake | MSYLILFLTGLLIGFVAGLLVYRRHSDRLKSTEDKGKTIIDALKGR* |
| JGI25908J49247_100275334 | 3300003277 | Freshwater Lake | MSYLILFLTGLLIGFVAGVLVYRKNGDRLKETETKGKNLLDALKGK* |
| JGI25907J50239_10599762 | 3300003394 | Freshwater Lake | MSYLILFLTGLLIGFVAGLLVYRRHSDRLKSTEDKGKTIIDALKGR*P* |
| Ga0049083_100463023 | 3300005580 | Freshwater Lentic | MSYLILFLTGLLIGFVAGVLVYRKNGDRLKETETKGKHLLDALKGK* |
| Ga0049081_100021586 | 3300005581 | Freshwater Lentic | MSYLILFLTGLLIGAVAGLLIYRKHAASLKASEDKGKSILDALKGR* |
| Ga0049081_100312065 | 3300005581 | Freshwater Lentic | MSYLILFLTGLLIGFVAGVLVYHKNGDRLKETEAKGKNLLDALKGK* |
| Ga0049082_102811863 | 3300005584 | Freshwater Lentic | MSYLILFLTGLLIGFVAGVLVYRKNGDRLKETETKGK |
| Ga0070744_100281471 | 3300006484 | Estuarine | MSYAILFITGLLIGFVAGVLVYRKNGDRLKETETKGKHLLDALKGK* |
| Ga0075464_101950603 | 3300006805 | Aqueous | MSYAILFLTGLLIGFVAGVLVYRKNGDRLKETETKGKNLLDALKGK* |
| Ga0075464_106394742 | 3300006805 | Aqueous | MFIALLFLTGLLIGFVAGLLVYRKHLDKLKAAEGKGKTILDALKGK* |
| Ga0102861_10140121 | 3300007544 | Estuarine | MSYLILFLTGLLIGFVAGLLVYRKHTDRLKSTEDKGKSIIDALKGR* |
| Ga0102861_10191851 | 3300007544 | Estuarine | LLIGVVAGILVYRKNGDRLKDTEAKGKNLLDALQGK* |
| Ga0102861_10990672 | 3300007544 | Estuarine | MSYLILFLTGLLIGVVAGILVYRKNGDRLKETEAKGKNLLDALKGK* |
| Ga0102873_100014438 | 3300007545 | Estuarine | MSYAILFIIGLLIGFTAGLLVYRKHIDKLKAAEGKGKSILDALKGK* |
| Ga0102920_10060891 | 3300007600 | Estuarine | RVTPLFPFPNMSYAILFIIGLLIGFTAGLLVYRKHIDKLKAAEGKGKSILDALKGK* |
| Ga0102862_12081511 | 3300007670 | Estuarine | LTGLLIGFVAGLLVYRKHTDRLKSTEDKGKSIIDALKGR* |
| Ga0105745_10950482 | 3300007972 | Estuary Water | MSYLILFTTGLLIGFVAGLLVYRKHTDRLKSTEDKGKSILDALKGR* |
| Ga0105747_11174273 | 3300007974 | Estuary Water | MSYLILFLTGLLIGVVAGLLVYRKHSDRIKSTEDKGKSIIDALKGR* |
| Ga0105747_12325922 | 3300007974 | Estuary Water | MSYLILFLTGLLIGVVAGILVYRKNGDRLKETETKGKHLLDALKGK* |
| Ga0108970_112909042 | 3300008055 | Estuary | MSYLILFLTGLLIGFVAGLLVYRKHTDRLKETETKGKNLLDALKGK* |
| Ga0114364_10146677 | 3300008267 | Freshwater, Plankton | MITSFLTGLVLGVIAGLLISRKNRSKLEAAEAKGKTILDALKGK* |
| Ga0114364_10146714 | 3300008267 | Freshwater, Plankton | MSYLILFITGLLIGFVAGLLVYRKHSDRLKSTEDKGKTIIDALKGR* |
| Ga0114364_10169522 | 3300008267 | Freshwater, Plankton | MLSLILFVTGLLIGLVAGLLIYRKHLDKLKAAEAKGKSIVDALKGR* |
| Ga0114364_10362795 | 3300008267 | Freshwater, Plankton | MLSLILFVTGLLIGLVAGLLIYRKHIEKLKAAEAKGKTIVDALKGR* |
| Ga0114364_10630033 | 3300008267 | Freshwater, Plankton | MLSLILFVTGLLIGLIAGLLIYRKHIEKLKAAEAKGKTIVDALKGR* |
| Ga0114880_11297332 | 3300008450 | Freshwater Lake | MLSLILFVAGLLIGLVAGLLIYRKHIEKLKAAEAKGKTIVDALKGR* |
| Ga0114880_11351052 | 3300008450 | Freshwater Lake | SLILFVTGLLIGLVAGLLIYRKHIEKLKAAEAKGKTIVDALKGR* |
| Ga0102831_10114605 | 3300008996 | Estuarine | MSDLFLFLPGLLIGFVAGLLVYRKHTDRLKSTEDKGKSIIDALKGR* |
| Ga0102816_13131852 | 3300008999 | Estuarine | MSYAILFITGLLIGFVAGVLVYRKNGDRLKETETKGKNLLDALKGK* |
| Ga0102864_10488513 | 3300009051 | Estuarine | MSYLILFTTGLLIGFVAGLLVYRKHTDRLKSTEDKGKSIIDALKGR* |
| Ga0102892_10370531 | 3300009057 | Estuarine | SPSSPPRVTPLFPFPNMSYAILFIIGLLIGFTAGLLVYRKHIDKLRAAEGKGKSILDALKGK* |
| Ga0114973_103384002 | 3300009068 | Freshwater Lake | MSYLILFLTGLLIGFVAGVLVYRKNADRLKETETKGKHLLDALKGK* |
| Ga0114980_100020439 | 3300009152 | Freshwater Lake | MTYAILFITGLLIGFVAGLLVYRKHSDRLKSTEDKGKTILDALKGR* |
| Ga0114968_101414661 | 3300009155 | Freshwater Lake | MSYLILFLTGLLIGFVAGILVYRKNGDRLKETETKGKHLLDALKGK* |
| Ga0114969_107432472 | 3300009181 | Freshwater Lake | MAYLYTFLTALLIGFVAGALVFRNNADKLKATETKGKN |
| Ga0114974_100393945 | 3300009183 | Freshwater Lake | MSYLILFLTGLLIGFVAGVLVYRKNGDRLKETEAKGKHLLDALKGK* |
| Ga0114982_10040128 | 3300009419 | Deep Subsurface | MYIALLFLTGLLIGFVAGLLVYRKHLDKLKAAEGKGKTILDALKGK* |
| Ga0136551_10375262 | 3300010388 | Pond Fresh Water | MSYVYTFLTGLLIGVLGGLLIYRKHLDKLKAAEAKGKSIVDALKGR* |
| Ga0133913_106556361 | 3300010885 | Freshwater Lake | MSYLILFLTGLLIGFVAGVLVYRKNGDRLKETEAKGKNLLDALKGK* |
| Ga0133913_113633741 | 3300010885 | Freshwater Lake | MSYLILFTTGLLIGFVAGLLVYRKHSDRLKSTEDKGKSILDALKGR* |
| Ga0133913_121252103 | 3300010885 | Freshwater Lake | MSYLILFTTGLLIGFVAGALVFRNNADKLKATETKGKNLLDALKGK* |
| Ga0153702_139626 | 3300011337 | Freshwater | MLHIILFVTGLLIGLVAGLLIYRKHLDKLKATEAKAKSIVDALKGR* |
| Ga0153799_10257343 | 3300012012 | Freshwater | MSYAILFTTGLLIGFVAGVLVYRKNGDRLKETETKGKNLLDALKGK* |
| Ga0153799_10733381 | 3300012012 | Freshwater | MSYLILFLTGLLIGFVAGLLVYRRHSDRLKETETKGKNLLDALKGK* |
| Ga0157210_10003652 | 3300012665 | Freshwater | MSYVYTFLTGLLIGILAGLLIYRKHLDKLKAAEAKGKTIVDALKGR* |
| Ga0157210_10334393 | 3300012665 | Freshwater | MLPLILFVTGLLIGLIAGLLIYRKHIEKLKAAEAKGKTIVDALKGR* |
| Ga0157498_10157133 | 3300012666 | Freshwater, Surface Ice | MSYLILFLTGLLIGFVAGVLVYRKNGDRLKETEAKGKHLIDALKGK* |
| Ga0177922_100847271 | 3300013372 | Freshwater | MSYLILFTTGLLIGFVAGLLVYRRHSDRLKSTEDKGKHL |
| Ga0177922_104849301 | 3300013372 | Freshwater | MSYLILFTTGLLIGFVAGLLVYRRHSDRLKETETKGKHLLDALKGK* |
| Ga0181346_12773513 | 3300017780 | Freshwater Lake | MSYLILFLTGLLIGFVAGLLVYRRHSDRLKSTEDK |
| Ga0181348_10590751 | 3300017784 | Freshwater Lake | MSYLILFLTGLLIGFVAGLLVYRRHSDRLKSTEDKG |
| Ga0181359_10113836 | 3300019784 | Freshwater Lake | MLSLILFVTGLLIGLVAGLLIYRKHIEKLKAAEAKGKTIVDALKGR |
| Ga0181359_10348531 | 3300019784 | Freshwater Lake | MSYLILFLTGLLIGFVAGVLVYRKNGDRLKETETKGKNLLDALKGK |
| Ga0181359_10555034 | 3300019784 | Freshwater Lake | MSYLILFLTGLLIGFVAGLLVYRRHSDRLKSTEDKGKTIIDALKGR |
| Ga0211736_100001252 | 3300020151 | Freshwater | MITSFLTGLVLGVIAGLLISRKNRSKLEAAEAKGKTILDALKGK |
| Ga0211736_105303273 | 3300020151 | Freshwater | MSYLILFLTGLLIGFVAGLLVYRKHAASLKSTEDKGKHLIDALKGR |
| Ga0211734_100135822 | 3300020159 | Freshwater | MSYLILFTTGLLIGIAAGLLIYRKHAASLKATEDKGKTILDALKGR |
| Ga0211729_102135554 | 3300020172 | Freshwater | MSYLILFVTGLLIGVAAGLLIYRKHSDRLKATEDKGKSILDALKGR |
| Ga0211731_104851543 | 3300020205 | Freshwater | MSYLILFVTGLLIGVAAGLLIYRKHAASLKSTEDKGKSILDALKGR |
| Ga0194048_101737312 | 3300021519 | Anoxic Zone Freshwater | MSYLILFTTGLLIGFVAGLLVYRKHLDKLKAAEGKGKSILDALKGK |
| Ga0222712_1000852512 | 3300021963 | Estuarine Water | MSYLILFTTGLLIGVVAGILVYRKNGEKLKATEAKGKSIIDALKGR |
| Ga0181354_10760572 | 3300022190 | Freshwater Lake | MSYLILFLTGLLIGFVAGLLVYRRHSDRLKSTETKGKNLLDALKGK |
| Ga0244777_1000039515 | 3300024343 | Estuarine | MSYAILFIIGLLIGFTAGLLVYRKHIDKLKAAEGKGKSILDALKGK |
| Ga0244775_101542524 | 3300024346 | Estuarine | MSYAILFITGLLIGFVAGVLVYRKNGDRLKETETKGKNLLDALKGK |
| Ga0244775_103630142 | 3300024346 | Estuarine | MSYLILFLTGLLIGFVAGLLVYRKHTDRLKSTEDKGKSIIDALKGR |
| Ga0255250_10816763 | 3300025763 | Freshwater | MLSLILFVTGLLIGLVAGLLIYRKHIEKLKAAEAKGKSIVDALKGR |
| Ga0255253_10430702 | 3300026429 | Freshwater | SLILFVTGLLIGLVAGLLIYRKHIEKLKAAEAKGKTIVDALKGR |
| Ga0256319_10422923 | 3300026454 | Freshwater | MLSLILFVTGLLIGLVAGLLIYRKHLDKLKAAEAKGKSIVDALKGR |
| Ga0208926_10038514 | 3300027205 | Estuarine | MSYLILFTTGLLIGFVAGLLVYRKHTDRLKSTEDKGKSILDALKGR |
| Ga0208926_10690221 | 3300027205 | Estuarine | MSYLILFLTGLLIGVVAGILVYRKNGDRLKETEAKGKNLLDALKGK |
| Ga0208164_10876151 | 3300027224 | Estuarine | RNTMSYLILFLTGLLIGFVAGLLVYRKHTDRLKSTEDKGKSIIDALKGR |
| Ga0208178_11000441 | 3300027259 | Estuarine | FPNMSYAILFIIGLLIGFTAGLLVYRKHIDKLKAAEGKGKSILDALKGK |
| Ga0208974_100081212 | 3300027608 | Freshwater Lentic | MSYLILFLTGLLIGAVAGLLIYRKHAASLKASEDKGKSILDALKGR |
| Ga0208974_10114376 | 3300027608 | Freshwater Lentic | MSYLILFLTGLLIGFVAGVLVYRKNGDRLKETETKGKNLLDA |
| Ga0208974_11538691 | 3300027608 | Freshwater Lentic | ILFVTGLLIGLVAGLLIYRKHIEKLKAAEAKGKTIVDALKGR |
| Ga0208974_11631812 | 3300027608 | Freshwater Lentic | LFLTGLLIGFVAGVLVYRKNGDRLKETETKGKNLLDALKGK |
| Ga0208133_10181214 | 3300027631 | Estuarine | MSYAILFITGLLIGFVAGVLVYRKNGDRLKETETKGKHLLDALKGK |
| Ga0208975_100161522 | 3300027659 | Freshwater Lentic | MSYLILFLTGLLIGFVAGVLVYHKNGDRLKETEAKGKNLLDALKGK |
| Ga0209033_10597013 | 3300027697 | Freshwater Lake | MLSLILFVTGLLIGLVAGLLIYRKHIEKLKAAEAKGKTIVDALKSR |
| Ga0209599_1000037834 | 3300027710 | Deep Subsurface | MYIALLFLTGLLIGFVAGLLVYRKHLDKLKAAEGKGKTILDALKGK |
| Ga0209442_11443431 | 3300027732 | Freshwater Lake | MSYLILFLTGLLIGFVAGVLVYRKNGDRLKETETKGKNL |
| Ga0209442_11735941 | 3300027732 | Freshwater Lake | YLILFLTGLLIGFVAGLLVYRRHSDRLKSTEDKGKTIIDALKGR |
| Ga0209297_100337716 | 3300027733 | Freshwater Lake | MTYAILFITGLLIGFVAGLLVYRKHSDRLKSTEDKGKTILDALKGR |
| Ga0209107_1000310224 | 3300027797 | Freshwater And Sediment | MSYIFTFLTGLLIGVLGGILVYRKNGDRLKETEAKGKSILDAIRGK |
| Ga0209107_1001595713 | 3300027797 | Freshwater And Sediment | MFYLILFTTGLLIGVAAGLLIYRKHSDRLKSTEDKGKSILDALKGR |
| Ga0209253_100598902 | 3300027900 | Freshwater Lake Sediment | MSYLILFTTGLLIGFVAGLLVYRKHSDRLKSTEDKGKTIIDALKGR |
| Ga0247723_10082219 | 3300028025 | Deep Subsurface Sediment | MFIALLFLTGLLIGFVAGLLVYRKHLDKLKAAEGKGKSILDALKGK |
| Ga0247723_10089133 | 3300028025 | Deep Subsurface Sediment | MYIALLFLTGLLIGFVAGLLVYRKHIEKLKAAEGKGKTILDALKGK |
| Ga0315291_107834362 | 3300031707 | Sediment | MSYLILFTTGLLIGVVAGILVYRKNGEKLKATEAKGKNLLDALKGK |
| Ga0315297_117193352 | 3300031873 | Sediment | FTTGLLIGVVAGILVYRKNGEKLKATEAKGKNLLDALKGK |
| Ga0315285_101084273 | 3300031885 | Sediment | MAYLILFTTGLLIGVVAGILVYRKNGEKLKATEAKGKNLLDALKGK |
| Ga0315278_117932772 | 3300031997 | Sediment | PITMAYLILFTTGLLIGVVAGILVYRKNGEKLKATEAKGKNLLDALKGK |
| Ga0315284_107115213 | 3300032053 | Sediment | MSYLILFTTGLLIGVVAGILVYRKNGEKLKATEAK |
| Ga0334979_0220159_794_934 | 3300033996 | Freshwater | MSYAIVFITALLIGFTAGLLVYRKHLEKLKAAEGKGKTILDALKGK |
| Ga0335029_0165958_502_642 | 3300034102 | Freshwater | MSYLILFLTGLLIGFVAGLLVYRKHSDRLKSTEDKGKSIIDALKGR |
| Ga0335035_0479995_59_199 | 3300034105 | Freshwater | MSYLILFTTGLLIGFVAGVLVYRKNGDRLKETEDKGKNLLDALKGK |
| Ga0335055_0070008_363_503 | 3300034110 | Freshwater | MSYAILFTTGLLIGFVAGLLVYRKHTDRLKSTEDKGKSIIDALKGR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |