| Basic Information | |
|---|---|
| Family ID | F105172 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MTLELNDYGLEFDTYVCYIALSWQVIIPATIALIAYKIYKRKKNK |
| Number of Associated Samples | 74 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 86.00 % |
| % of genes near scaffold ends (potentially truncated) | 34.00 % |
| % of genes from short scaffolds (< 2000 bps) | 82.00 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (42.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.53% β-sheet: 0.00% Coil/Unstructured: 42.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 5.00 |
| PF00041 | fn3 | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 58.00 % |
| Unclassified | root | N/A | 42.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109820318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1468 | Open in IMG/M |
| 3300005517|Ga0070374_10447914 | Not Available | 647 | Open in IMG/M |
| 3300005525|Ga0068877_10689985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300005527|Ga0068876_10004159 | Not Available | 10226 | Open in IMG/M |
| 3300005662|Ga0078894_10187059 | All Organisms → Viruses → Predicted Viral | 1872 | Open in IMG/M |
| 3300005662|Ga0078894_10302243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1451 | Open in IMG/M |
| 3300005662|Ga0078894_10530577 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
| 3300005662|Ga0078894_10556626 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300005662|Ga0078894_11216616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300005662|Ga0078894_11766527 | Not Available | 505 | Open in IMG/M |
| 3300006484|Ga0070744_10066159 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300006484|Ga0070744_10180618 | Not Available | 602 | Open in IMG/M |
| 3300006639|Ga0079301_1139881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300006641|Ga0075471_10072734 | Not Available | 1877 | Open in IMG/M |
| 3300006641|Ga0075471_10201866 | Not Available | 1035 | Open in IMG/M |
| 3300006641|Ga0075471_10202558 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300006641|Ga0075471_10413259 | Not Available | 676 | Open in IMG/M |
| 3300006875|Ga0075473_10065539 | All Organisms → Viruses → Predicted Viral | 1415 | Open in IMG/M |
| 3300006875|Ga0075473_10203828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
| 3300007559|Ga0102828_1143732 | Not Available | 596 | Open in IMG/M |
| 3300007560|Ga0102913_1211972 | Not Available | 621 | Open in IMG/M |
| 3300007617|Ga0102897_1228639 | Not Available | 553 | Open in IMG/M |
| 3300007708|Ga0102859_1201091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300008107|Ga0114340_1234637 | Not Available | 574 | Open in IMG/M |
| 3300008110|Ga0114343_1139908 | All Organisms → Viruses → Predicted Viral | 2111 | Open in IMG/M |
| 3300008111|Ga0114344_1024607 | All Organisms → Viruses → Predicted Viral | 2423 | Open in IMG/M |
| 3300008111|Ga0114344_1036059 | All Organisms → Viruses → Predicted Viral | 2713 | Open in IMG/M |
| 3300008111|Ga0114344_1080918 | All Organisms → Viruses → Predicted Viral | 1824 | Open in IMG/M |
| 3300008113|Ga0114346_1209227 | Not Available | 770 | Open in IMG/M |
| 3300008116|Ga0114350_1170805 | Not Available | 574 | Open in IMG/M |
| 3300008120|Ga0114355_1130027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 930 | Open in IMG/M |
| 3300008261|Ga0114336_1104179 | All Organisms → Viruses → Predicted Viral | 1928 | Open in IMG/M |
| 3300008262|Ga0114337_1316532 | Not Available | 548 | Open in IMG/M |
| 3300008266|Ga0114363_1201097 | Not Available | 611 | Open in IMG/M |
| 3300008448|Ga0114876_1101576 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
| 3300008953|Ga0104241_1000632 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2826 | Open in IMG/M |
| 3300008996|Ga0102831_1109005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300009081|Ga0105098_10731127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300010354|Ga0129333_11141030 | Not Available | 649 | Open in IMG/M |
| 3300010370|Ga0129336_10671298 | Not Available | 550 | Open in IMG/M |
| 3300010374|Ga0114986_1104176 | Not Available | 514 | Open in IMG/M |
| 3300011381|Ga0102688_1635839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
| 3300014050|Ga0119952_1081934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300019146|Ga0188881_10012585 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| 3300020162|Ga0211735_10606238 | Not Available | 861 | Open in IMG/M |
| 3300020519|Ga0208223_1007921 | All Organisms → Viruses → Predicted Viral | 1789 | Open in IMG/M |
| 3300021140|Ga0214168_1015231 | All Organisms → Viruses → Predicted Viral | 2266 | Open in IMG/M |
| 3300021962|Ga0222713_10089747 | All Organisms → Viruses → Predicted Viral | 2227 | Open in IMG/M |
| 3300021962|Ga0222713_10133714 | All Organisms → Viruses → Predicted Viral | 1733 | Open in IMG/M |
| 3300021962|Ga0222713_10209310 | All Organisms → Viruses → Predicted Viral | 1298 | Open in IMG/M |
| 3300021962|Ga0222713_10632402 | Not Available | 620 | Open in IMG/M |
| 3300021963|Ga0222712_10064488 | All Organisms → Viruses → Predicted Viral | 2671 | Open in IMG/M |
| 3300022747|Ga0228703_1023346 | All Organisms → Viruses → Predicted Viral | 1950 | Open in IMG/M |
| 3300022752|Ga0214917_10007613 | Not Available | 10900 | Open in IMG/M |
| 3300022752|Ga0214917_10289299 | Not Available | 736 | Open in IMG/M |
| 3300023174|Ga0214921_10011400 | Not Available | 10810 | Open in IMG/M |
| 3300024289|Ga0255147_1000435 | Not Available | 12174 | Open in IMG/M |
| 3300024289|Ga0255147_1002771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4193 | Open in IMG/M |
| 3300024289|Ga0255147_1004573 | All Organisms → Viruses → Predicted Viral | 3186 | Open in IMG/M |
| 3300024289|Ga0255147_1053572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300024289|Ga0255147_1062007 | Not Available | 714 | Open in IMG/M |
| 3300024306|Ga0255148_1023211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1177 | Open in IMG/M |
| 3300024346|Ga0244775_10569191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 921 | Open in IMG/M |
| 3300024348|Ga0244776_10261702 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
| 3300024348|Ga0244776_10820360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300024350|Ga0255167_1029423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1023 | Open in IMG/M |
| 3300024354|Ga0255171_1066365 | Not Available | 661 | Open in IMG/M |
| 3300024481|Ga0256330_1052285 | Not Available | 870 | Open in IMG/M |
| 3300024496|Ga0255151_1032047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300024500|Ga0255143_1014919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Eikenella → unclassified Eikenella → Eikenella sp. HMSC061C02 | 1316 | Open in IMG/M |
| 3300024574|Ga0255275_1063406 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
| 3300024867|Ga0255267_1086333 | Not Available | 726 | Open in IMG/M |
| 3300024867|Ga0255267_1154677 | Not Available | 528 | Open in IMG/M |
| 3300025732|Ga0208784_1016285 | Not Available | 2458 | Open in IMG/M |
| 3300025732|Ga0208784_1026711 | Not Available | 1851 | Open in IMG/M |
| 3300025848|Ga0208005_1155437 | Not Available | 713 | Open in IMG/M |
| 3300026455|Ga0255155_1022572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1128 | Open in IMG/M |
| 3300026459|Ga0255170_1002156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5043 | Open in IMG/M |
| 3300026478|Ga0255156_1088484 | Not Available | 546 | Open in IMG/M |
| 3300026570|Ga0255274_1054005 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
| 3300027121|Ga0255074_1003816 | All Organisms → Viruses → Predicted Viral | 2148 | Open in IMG/M |
| 3300027141|Ga0255076_1033722 | Not Available | 915 | Open in IMG/M |
| 3300027153|Ga0255083_1087850 | Not Available | 581 | Open in IMG/M |
| 3300027488|Ga0255084_1038621 | Not Available | 884 | Open in IMG/M |
| 3300027529|Ga0255077_1031680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 970 | Open in IMG/M |
| 3300027631|Ga0208133_1089068 | Not Available | 724 | Open in IMG/M |
| 3300027793|Ga0209972_10148402 | All Organisms → Viruses → Predicted Viral | 1126 | Open in IMG/M |
| 3300027805|Ga0209229_10510550 | Not Available | 512 | Open in IMG/M |
| 3300028091|Ga0255184_1100251 | Not Available | 535 | Open in IMG/M |
| 3300028103|Ga0255172_1062146 | Not Available | 679 | Open in IMG/M |
| 3300031857|Ga0315909_10215353 | All Organisms → Viruses → Predicted Viral | 1507 | Open in IMG/M |
| 3300031857|Ga0315909_10266123 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
| 3300031857|Ga0315909_10325975 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
| 3300031963|Ga0315901_10207857 | All Organisms → Viruses → Predicted Viral | 1688 | Open in IMG/M |
| 3300031963|Ga0315901_10318765 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
| 3300032050|Ga0315906_10011128 | Not Available | 10513 | Open in IMG/M |
| 3300032093|Ga0315902_10228482 | All Organisms → Viruses → Predicted Viral | 1834 | Open in IMG/M |
| 3300033816|Ga0334980_0000111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 39255 | Open in IMG/M |
| 3300034118|Ga0335053_0526540 | Not Available | 692 | Open in IMG/M |
| 3300034166|Ga0335016_0461456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 25.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.00% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 11.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.00% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.00% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.00% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007560 | Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
| 3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300019146 | Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024350 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300024481 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300024574 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024867 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
| 3300026459 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300026570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027141 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300027153 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027488 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300028091 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_1098203183 | 3300002408 | Freshwater | MTLELNNYGLEFDTYVCYIAIAWQVLIPTTLALIAYKIYKVRKTK* |
| Ga0070374_104479143 | 3300005517 | Freshwater Lake | MTIELNDYGFVFDTYVCYIALSWQFLAPVAVALIAYKIYKRKKNK* |
| Ga0068877_106899853 | 3300005525 | Freshwater Lake | MTLELNDYGLEFDTYVCYIALSWQVIIPATIALIAYKIYKWKKNN* |
| Ga0068876_100041592 | 3300005527 | Freshwater Lake | MTLELNDYGLEFDTYVCYIALSWQVIIPATIALIAYKVYKRMRVK* |
| Ga0078894_101870593 | 3300005662 | Freshwater Lake | MTIELNDYGFVFDTYVCYIALSWQFLAPATIALIAYKIYKRKKNK* |
| Ga0078894_103022434 | 3300005662 | Freshwater Lake | MTLELNDYGLEFDTYVCYIALSWQVLIPSAIALIAYKIYKRKKNK* |
| Ga0078894_105305775 | 3300005662 | Freshwater Lake | MTLKLNDYGLEFDTYVCYIALSWQVIIPATIALIAYKIYKRKK |
| Ga0078894_105566266 | 3300005662 | Freshwater Lake | MTLELNDYGLEFDTYVCYIALSWQVIIPATIALIAYKIYKRKK |
| Ga0078894_112166163 | 3300005662 | Freshwater Lake | MTIRLNDYGFELDTYICYIALSWQILIPATIALIAYKFYKRKKNK* |
| Ga0078894_117665272 | 3300005662 | Freshwater Lake | MTIELNDYGFVFDTYVCYIALSWQFLIPASIVLIGYKVIKRKKNK* |
| Ga0070744_100661595 | 3300006484 | Estuarine | MTIELNDYGFCLDTYVCYIALSWQVLIPATIALIAYKIIKR |
| Ga0070744_101806181 | 3300006484 | Estuarine | MTIELNDYGFVFDTYVCYIALSWQFLAPATIALIAYKIIKRKKNK* |
| Ga0079301_11398812 | 3300006639 | Deep Subsurface | MTLELNDYGLEFDTYVCYIALSWQILIPATIALIAYKIYKWKKNN* |
| Ga0075471_100727342 | 3300006641 | Aqueous | MTIELNDYGFEFDTYVAYIALSWQVLIPATIAIVAYKVYKRLRDK* |
| Ga0075471_102018662 | 3300006641 | Aqueous | MTLELNDYGFEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKITK* |
| Ga0075471_102025581 | 3300006641 | Aqueous | MTLELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKITK* |
| Ga0075471_104132591 | 3300006641 | Aqueous | GLEFDTYVCYIALSWQILIPATIALIAYKFYKRKKNK* |
| Ga0075473_100655394 | 3300006875 | Aqueous | MTIELNEYGFEFDTYIAYIALSWQVIIPAAILFIGYKFYKMKGKKK* |
| Ga0075473_102038281 | 3300006875 | Aqueous | MTLELNDYGFEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKIT |
| Ga0102828_11437322 | 3300007559 | Estuarine | MTLELNDYGLEFDTYVCYIALSWQVIVPALISVIAYKIYKRKKNK* |
| Ga0102913_12119723 | 3300007560 | Estuarine | MTLELNDYGLEFDTYVCYIALSWQVIIPALISVIAYKIYKRKKNK* |
| Ga0102897_12286391 | 3300007617 | Estuarine | MTLELNDYGFEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKNK* |
| Ga0102859_12010913 | 3300007708 | Estuarine | MTIELNDYGFVFDTYVCYIALSWQFLIPASIVLIAYKVIKRKKN |
| Ga0114340_12346372 | 3300008107 | Freshwater, Plankton | MTLELNDYGLEFDTYVCYIALSWQVLIPATIAIIAYKIYKRKKNN* |
| Ga0114343_11399083 | 3300008110 | Freshwater, Plankton | MTLELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKNN* |
| Ga0114344_10246074 | 3300008111 | Freshwater, Plankton | MTLELNDYGLEFDTYICYIALSWQILIPATIALIAYKFYKRKKNK* |
| Ga0114344_103605910 | 3300008111 | Freshwater, Plankton | MTLELNDYGLEFDTYVCYIALSWQVIIPATIALIAYKIIKRKKNK* |
| Ga0114344_10809185 | 3300008111 | Freshwater, Plankton | MTLELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKNI* |
| Ga0114346_12092271 | 3300008113 | Freshwater, Plankton | MTIRLNDYGFELDTYICYIALSWQILIPATIALIAYKFYKRKKN |
| Ga0114350_11708052 | 3300008116 | Freshwater, Plankton | YGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKNN* |
| Ga0114355_11300273 | 3300008120 | Freshwater, Plankton | MTIRLNDYGFELDTYICYIALSWQILTPATIALIAYKFYKRK |
| Ga0114336_11041795 | 3300008261 | Freshwater, Plankton | MTLELNDYGLEFDTYVCYIALSWQVIIPVTIALIAYKVYKRMRVK* |
| Ga0114337_13165322 | 3300008262 | Freshwater, Plankton | MTLELNDYGLEFDTYVCYIALSWQILIPATIALVVYKKNQW* |
| Ga0114363_12010971 | 3300008266 | Freshwater, Plankton | LGDIRIMTLELNDYGLEFDTYVCYIALSWQVLIPATIAIIAYKIYKRKKNN* |
| Ga0114876_11015764 | 3300008448 | Freshwater Lake | MTIRLNDYGFELDTYICYIALSWQILIPATIALIAY |
| Ga0104241_10006325 | 3300008953 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVIVPAVIALIAYKIYKRKKNK* |
| Ga0102831_11090053 | 3300008996 | Estuarine | MTIELNEYGLEFDTYVCYIALSWQVIIPALISVIAYKIYKRKKNK* |
| Ga0105098_107311271 | 3300009081 | Freshwater Sediment | MTIELNDYGFVFDTYVCYIALSWQFLAPATIALIAYKIYKRKKAK* |
| Ga0129333_111410303 | 3300010354 | Freshwater To Marine Saline Gradient | MKLELNDYGLEFDTYVCYIALSWQVLIPATLALIAYKIYKWKKNN* |
| Ga0129336_106712981 | 3300010370 | Freshwater To Marine Saline Gradient | RTNTRLGDIRIMTLELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKNN* |
| Ga0114986_11041762 | 3300010374 | Deep Subsurface | MTIELNDYGFVFDTYVCYIALSWQFLAPVAVALIAYKIYK |
| Ga0102688_16358391 | 3300011381 | Freshwater Lake | MTLELNDYGLEFDTYICYIALSWQILIPATIALIAYK |
| Ga0119952_10819344 | 3300014050 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQILIPATIALIAYKIYKRKKNKYDY* |
| Ga0188881_100125852 | 3300019146 | Freshwater Lake | MTLRLNDYGLEFDTYVCYIALSWQILIPATIALIAYKIYKWKKNK |
| Ga0211735_106062383 | 3300020162 | Freshwater | GLEFDTYVCYIALSWQVIIPALISVIAYKIYKRKKNK |
| Ga0208223_10079212 | 3300020519 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKNN |
| Ga0214168_10152314 | 3300021140 | Freshwater | MTLRINDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKITK |
| Ga0222713_100897474 | 3300021962 | Estuarine Water | MTLELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKITK |
| Ga0222713_101337145 | 3300021962 | Estuarine Water | MTLELNDYGLEFDTYICYIALSWQVIIPATIALIAYKVYKRMRVK |
| Ga0222713_102093101 | 3300021962 | Estuarine Water | MTLELNDYGLEFDTYICYIALSWQILIPATIALIAYKIYKW |
| Ga0222713_106324022 | 3300021962 | Estuarine Water | MTIELNDYGFVFDTYVCYIALSWQFLAPVAVALIAYKIYKRKKNK |
| Ga0222712_1006448810 | 3300021963 | Estuarine Water | MTLELNDYGLEFDTYVCYIALSWQVIIPATIALIAYKVYKRMRVK |
| Ga0228703_10233464 | 3300022747 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVIVPAVIALIAYKIYKRKKNK |
| Ga0214917_1000761330 | 3300022752 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRMKNKNVY |
| Ga0214917_102892992 | 3300022752 | Freshwater | MTIELNDYGFELDTYVAYIALSWQVLIPALIVFIGYKIYKRKQRVF |
| Ga0214921_1001140010 | 3300023174 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQILIPATIALIAYKIYKRKKNK |
| Ga0255147_100043533 | 3300024289 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVLIPALIIGIGYKIYKMKGKKK |
| Ga0255147_100277110 | 3300024289 | Freshwater | MTLELNDYGLEFDTYVAYIALSWQVIVPATIALIAYKIYKKMKNKNVY |
| Ga0255147_10045738 | 3300024289 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQILIPATLALIAYKIYKRKKNKNVF |
| Ga0255147_10535724 | 3300024289 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRMKNK |
| Ga0255147_10620071 | 3300024289 | Freshwater | MTLELNDYGLEFDTYVAYIALSWQVLIPATIALIAYKIYKRMKNKNVY |
| Ga0255148_10232113 | 3300024306 | Freshwater | MTLELNGYGLEFDTYVAYIALSWQVLIPATIALIAYKIYKRMKNKNVY |
| Ga0244775_105691913 | 3300024346 | Estuarine | MTIELNEYGLEFDTYVCYIALSWQVIIPALISVIAYKIYKRKKNK |
| Ga0244776_102617024 | 3300024348 | Estuarine | MTLELNDYGLEFDTYVCYIALSWQILIPATLALIAYKIYKRKKNN |
| Ga0244776_108203604 | 3300024348 | Estuarine | MTIELNDYGFVFDTYVCYIALSWQFLVPATLALIAYKIY |
| Ga0255167_10294233 | 3300024350 | Freshwater | TKIKMTLELNDYGLEFDTYVAYIALSWQVIVPATIALIAYKIYKRMKNKNVY |
| Ga0255171_10663651 | 3300024354 | Freshwater | LELNDYGLEFDTYVCYIALSWQVIIPAVIALVAYKIYKRKKNKXVLIAY |
| Ga0256330_10522853 | 3300024481 | Freshwater | MTLELNDYGLEFDTYVAYIALSWQVIVPATIALIAYKIYKRMKNKNVY |
| Ga0255151_10320474 | 3300024496 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIY |
| Ga0255143_10149195 | 3300024500 | Freshwater | KIKMTLELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRMKNKNVY |
| Ga0255275_10634061 | 3300024574 | Freshwater | MTLELNDYGLEFDTYVAYIALSWQVIIPALIIGIGYKI |
| Ga0255267_10863333 | 3300024867 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVIIPAAIALIAYKIYKKMKNKNVY |
| Ga0255267_11546772 | 3300024867 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVLIPALIIGIGYKIYKVRKNKYDF |
| Ga0208784_101628510 | 3300025732 | Aqueous | MTLELNDYGFEFDTYVCYIALSWQVLIPATIAIIAYKIYKRKKITK |
| Ga0208784_10267116 | 3300025732 | Aqueous | MTIELNDYGFEFDTYVAYIALSWQVLIPATIAIVAYKVYKRLRDK |
| Ga0208005_11554371 | 3300025848 | Aqueous | MTLELNDYGFEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKI |
| Ga0255155_10225723 | 3300026455 | Freshwater | MTLELNDYGLEFDTYVAYIALSWQVIIPALIIGIGYKIYKVRKNKYDF |
| Ga0255170_100215614 | 3300026459 | Freshwater | MTLELNDYGLEFDTYVAYIALSWQVLIPATIALIAYKIYKKMKNKNVY |
| Ga0255156_10884842 | 3300026478 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVLIPAAIALIAYKIYKKRNKKKXR |
| Ga0255274_10540051 | 3300026570 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRMKNKN |
| Ga0255074_10038166 | 3300027121 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVIIPATIALIAYKIYKRKKITK |
| Ga0255076_10337223 | 3300027141 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVIIPATIALIAYKIYKRKKITKXTAY |
| Ga0255083_10878501 | 3300027153 | Freshwater | LELNDYGFEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKNK |
| Ga0255084_10386211 | 3300027488 | Freshwater | LNDYGLEFDTYVCYIALSWQVIIPATIALIAYKIYKRKKITRXVLIAY |
| Ga0255077_10316801 | 3300027529 | Freshwater | MTLELNDYGFEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKNK |
| Ga0208133_10890681 | 3300027631 | Estuarine | MTIELNDYGFVFDTYVCYIALSWQFLAPATIALIAYKIIKRKKNK |
| Ga0209972_101484021 | 3300027793 | Freshwater Lake | MTLELNDYGLEFDTYICYIALSWQILIPATIALIAYKFYK |
| Ga0209229_105105502 | 3300027805 | Freshwater And Sediment | ELNDYGLEFDTYICYIALSWQVIIPATIGLIAYKVYKRMRVK |
| Ga0255184_11002512 | 3300028091 | Freshwater | MTLELNDYGLEFDTYVAYIALSWQVIVPATIALIAYKI |
| Ga0255172_10621461 | 3300028103 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVIIPAVIALVAYKIYKRKTKKK |
| Ga0315909_102153531 | 3300031857 | Freshwater | LELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKNI |
| Ga0315909_102661235 | 3300031857 | Freshwater | LELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKNN |
| Ga0315909_103259751 | 3300031857 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVLIPATIALIAYKIYKRKKN |
| Ga0315901_102078575 | 3300031963 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVIIPATIALIAYKIYKRKKNK |
| Ga0315901_103187652 | 3300031963 | Freshwater | MTIRLNDYGFELDTYICYIALSWQILIPATIALIAYKFYKRKKNK |
| Ga0315906_1001112827 | 3300032050 | Freshwater | RSRGKVMTLELNDYGLEFDTYVCYIALSWQVIIPATIALIAYKVYKRMRVK |
| Ga0315902_102284825 | 3300032093 | Freshwater | MTLELNDYGLEFDTYVCYIALSWQVLIPATIAIIAYKIYKRKKNN |
| Ga0334980_0000111_32603_32740 | 3300033816 | Freshwater | MTIELNDYGFVFDTYVCYIALSWQFLAPATIALIAYKIYKRKKAK |
| Ga0335053_0526540_30_167 | 3300034118 | Freshwater | MTIELNDYGFVFDTYVCYIALSWQFLAPATIALIAYKIYKRKKAN |
| Ga0335016_0461456_241_378 | 3300034166 | Freshwater | MTLELNNYGLEFDTYVCYIAIAWQVLIPTTLALIAYKIYKVRKTK |
| ⦗Top⦘ |