NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105154

Metagenome / Metatranscriptome Family F105154

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105154
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 43 residues
Representative Sequence MLQLNPMIPIIRVSDKMEGYAFLVIDYSQEHDLLFTCAMDDG
Number of Associated Samples 86
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 19.00 %
% of genes near scaffold ends (potentially truncated) 91.00 %
% of genes from short scaffolds (< 2000 bps) 85.00 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (58.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(16.000 % of family members)
Environment Ontology (ENVO) Unclassified
(44.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(62.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 32.86%    Coil/Unstructured: 67.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF12705PDDEXK_1 9.00
PF02562PhoH 5.00
PF01223Endonuclease_NS 3.00
PF13391HNH_2 1.00
PF00041fn3 1.00
PF00145DNA_methylase 1.00
PF00149Metallophos 1.00
PF08800VirE_N 1.00
PF10269Tmemb_185A 1.00
PF02151UVR 1.00
PF00216Bac_DNA_binding 1.00
PF00085Thioredoxin 1.00
PF13506Glyco_transf_21 1.00
PF06067DUF932 1.00
PF05118Asp_Arg_Hydrox 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG1702Phosphate starvation-inducible protein PhoH, predicted ATPaseSignal transduction mechanisms [T] 5.00
COG1875Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domainsGeneral function prediction only [R] 5.00
COG1864DNA/RNA endonuclease G, NUC1Nucleotide transport and metabolism [F] 3.00
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 1.00
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 1.00
COG3555Aspartyl/asparaginyl beta-hydroxylase, cupin superfamilyPosttranslational modification, protein turnover, chaperones [O] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A58.00 %
All OrganismsrootAll Organisms42.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000928|OpTDRAFT_10324475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria586Open in IMG/M
3300002408|B570J29032_108769569Not Available506Open in IMG/M
3300005525|Ga0068877_10199059Not Available1200Open in IMG/M
3300005527|Ga0068876_10493157Not Available673Open in IMG/M
3300005662|Ga0078894_11297429Not Available612Open in IMG/M
3300005805|Ga0079957_1335786All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300006484|Ga0070744_10209657All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300006863|Ga0075459_1000236Not Available8298Open in IMG/M
3300007523|Ga0105052_11032380Not Available510Open in IMG/M
3300007546|Ga0102874_1165802Not Available684Open in IMG/M
3300007590|Ga0102917_1212625Not Available674Open in IMG/M
3300007593|Ga0102918_1195421Not Available615Open in IMG/M
3300007642|Ga0102876_1181460Not Available560Open in IMG/M
3300007644|Ga0102902_1203412All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage584Open in IMG/M
3300007658|Ga0102898_1030258Not Available1212Open in IMG/M
3300007706|Ga0102899_1089988Not Available744Open in IMG/M
3300007708|Ga0102859_1269149Not Available513Open in IMG/M
3300007992|Ga0105748_10141578Not Available982Open in IMG/M
3300008262|Ga0114337_1231060All Organisms → Viruses → Predicted Viral1333Open in IMG/M
3300008266|Ga0114363_1048104Not Available3015Open in IMG/M
3300008266|Ga0114363_1076916All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus1253Open in IMG/M
3300008266|Ga0114363_1116755All Organisms → Viruses → Predicted Viral1679Open in IMG/M
3300008266|Ga0114363_1141157All Organisms → Viruses → Predicted Viral1147Open in IMG/M
3300008267|Ga0114364_1010020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Aquirufa → Aquirufa lenticrescens4399Open in IMG/M
3300008339|Ga0114878_1053166All Organisms → Viruses → Predicted Viral1709Open in IMG/M
3300008448|Ga0114876_1157044Not Available822Open in IMG/M
3300008950|Ga0102891_1031219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1681Open in IMG/M
3300009151|Ga0114962_10697496Not Available519Open in IMG/M
3300009154|Ga0114963_10325637Not Available849Open in IMG/M
3300009158|Ga0114977_10156114All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1356Open in IMG/M
3300009161|Ga0114966_10751825Not Available529Open in IMG/M
3300009169|Ga0105097_10904442Not Available507Open in IMG/M
3300009182|Ga0114959_10152322All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1228Open in IMG/M
3300009187|Ga0114972_10290324Not Available973Open in IMG/M
3300010157|Ga0114964_10000127Not Available56631Open in IMG/M
3300010334|Ga0136644_10667125Not Available567Open in IMG/M
3300010354|Ga0129333_11468569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriales incertae sedis → Microseira → Microseira wollei559Open in IMG/M
3300010885|Ga0133913_10478271Not Available3284Open in IMG/M
3300010885|Ga0133913_10881046All Organisms → Viruses → Predicted Viral2326Open in IMG/M
3300010885|Ga0133913_11053857All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium2098Open in IMG/M
3300010885|Ga0133913_11309718Not Available1849Open in IMG/M
3300010885|Ga0133913_11431850All Organisms → Viruses → Predicted Viral1755Open in IMG/M
3300012266|Ga0136712_1015239Not Available844Open in IMG/M
3300013005|Ga0164292_10251690Not Available1230Open in IMG/M
3300014811|Ga0119960_1024004Not Available820Open in IMG/M
3300014811|Ga0119960_1054337Not Available671Open in IMG/M
3300017778|Ga0181349_1212737Not Available663Open in IMG/M
3300017778|Ga0181349_1272917Not Available556Open in IMG/M
3300017784|Ga0181348_1159051Not Available840Open in IMG/M
3300017785|Ga0181355_1003904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Rufibacter → unclassified Rufibacter → Rufibacter sp. SYSU D004336614Open in IMG/M
3300017785|Ga0181355_1139584Not Available983Open in IMG/M
3300019784|Ga0181359_1149564Not Available802Open in IMG/M
3300020048|Ga0207193_1020280All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes8375Open in IMG/M
3300020141|Ga0211732_1201130Not Available935Open in IMG/M
3300020151|Ga0211736_11034008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1208Open in IMG/M
3300020159|Ga0211734_10184313All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage848Open in IMG/M
3300020159|Ga0211734_10921579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage695Open in IMG/M
3300020205|Ga0211731_11034959Not Available833Open in IMG/M
3300020528|Ga0208224_1031972Not Available690Open in IMG/M
3300021519|Ga0194048_10207536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage723Open in IMG/M
3300021956|Ga0213922_1084178Not Available658Open in IMG/M
3300021961|Ga0222714_10526305Not Available602Open in IMG/M
3300021962|Ga0222713_10313123All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon995Open in IMG/M
3300021962|Ga0222713_10334166Not Available953Open in IMG/M
3300021962|Ga0222713_10597044Not Available645Open in IMG/M
3300021963|Ga0222712_10089871All Organisms → cellular organisms → Bacteria2173Open in IMG/M
3300021963|Ga0222712_10817019Not Available512Open in IMG/M
3300022200|Ga0196901_1004740All Organisms → cellular organisms → Bacteria6135Open in IMG/M
3300022407|Ga0181351_1012044All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum3535Open in IMG/M
3300024298|Ga0255178_1109014All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon505Open in IMG/M
3300024356|Ga0255169_1039346Not Available835Open in IMG/M
3300024566|Ga0256309_1014658All Organisms → Viruses → Predicted Viral2140Open in IMG/M
3300025789|Ga0208499_1051340All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300027127|Ga0255071_1006753All Organisms → Viruses → Predicted Viral1969Open in IMG/M
3300027134|Ga0255069_1030912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300027145|Ga0255114_1081293Not Available554Open in IMG/M
3300027595|Ga0255122_1089533All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes504Open in IMG/M
3300027644|Ga0209356_1082084Not Available958Open in IMG/M
3300027734|Ga0209087_1060465All Organisms → Viruses → Predicted Viral1699Open in IMG/M
3300027736|Ga0209190_1236733Not Available730Open in IMG/M
3300027797|Ga0209107_10558688Not Available501Open in IMG/M
3300028105|Ga0255254_1053627Not Available815Open in IMG/M
3300028108|Ga0256305_1092722All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Muribaculaceae → unclassified Muribaculaceae → Muribaculaceae bacterium Isolate-007 (NCI)732Open in IMG/M
3300028394|Ga0304730_1179352Not Available822Open in IMG/M
3300029999|Ga0311339_10600378Not Available1096Open in IMG/M
3300031758|Ga0315907_10000086All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium126523Open in IMG/M
3300031857|Ga0315909_10553665All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300031951|Ga0315904_10392900All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus1260Open in IMG/M
3300031952|Ga0315294_10847155Not Available781Open in IMG/M
3300032050|Ga0315906_11071894All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus598Open in IMG/M
3300032093|Ga0315902_11221162All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300032116|Ga0315903_10937768Not Available614Open in IMG/M
3300032143|Ga0315292_10592640Not Available934Open in IMG/M
3300032462|Ga0335396_10287413Not Available1073Open in IMG/M
3300032675|Ga0316225_1115253All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage894Open in IMG/M
3300034096|Ga0335025_0652851Not Available514Open in IMG/M
3300034102|Ga0335029_0345363Not Available920Open in IMG/M
3300034106|Ga0335036_0184619Not Available1459Open in IMG/M
3300034355|Ga0335039_0048462All Organisms → Viruses → Predicted Viral2566Open in IMG/M
3300034357|Ga0335064_0897758Not Available534Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake16.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake11.00%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater9.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine9.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.00%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton6.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater6.00%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water6.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.00%
AquaticEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic2.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater2.00%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.00%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater1.00%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment1.00%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater1.00%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake1.00%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.00%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater1.00%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.00%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.00%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.00%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine1.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300007523Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03EnvironmentalOpen in IMG/M
3300007546Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02EnvironmentalOpen in IMG/M
3300007590Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300007644Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02EnvironmentalOpen in IMG/M
3300007658Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3EnvironmentalOpen in IMG/M
3300007706Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3EnvironmentalOpen in IMG/M
3300007708Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02EnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008267Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTREnvironmentalOpen in IMG/M
3300008339Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigsEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300008950Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300010157Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaGEnvironmentalOpen in IMG/M
3300010334Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012266Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaGEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300014811Aquatic viral communities from ballast water - Michigan State University - AB_ballast waterEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020141Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1EnvironmentalOpen in IMG/M
3300020151Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1EnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020528Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021519Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5mEnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300024298Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8dEnvironmentalOpen in IMG/M
3300024356Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8dEnvironmentalOpen in IMG/M
3300024566Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025789Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300027127Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8hEnvironmentalOpen in IMG/M
3300027134Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8hEnvironmentalOpen in IMG/M
3300027145Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8hEnvironmentalOpen in IMG/M
3300027595Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8hEnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300028105Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028108Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028394Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032462Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)EnvironmentalOpen in IMG/M
3300032675Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015EnvironmentalOpen in IMG/M
3300034096Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098EnvironmentalOpen in IMG/M
3300034102Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M
3300034357Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OpTDRAFT_1032447523300000928Freshwater And MarineMLQLNPMIPIVRVSDKMEGFAFMVIDYSQEHNLLFVCGMDDGEIWTL
B570J29032_10876956923300002408FreshwaterMILQLNPMIPILRVSDGMEGYAFLVIDYSQEHNLLFTCAMDD
Ga0068877_1019905913300005525Freshwater LakeMMLQLNPMLPIIRNSDGMKGFAFLVIDYSQEHDLLFTCAMDDGEIWTLSNKE
Ga0068876_1049315713300005527Freshwater LakeMLQLNPMIPIYSIEHKMEGYAFLVIDYSQEHDLLF
Ga0078894_1129742913300005662Freshwater LakeMMLQLNPMLPIVRVSDGMEGYAFLVIDYSQEHYTLFTCAMDNGEI
Ga0079957_133578623300005805LakeMIPVKRISDNMKGYAFLVIDYSQEHDLLFTCAMDDG
Ga0070744_1020965733300006484EstuarineMIPIIRVSDKMEGYAFLVIDYSQEHNLLFTCAMDD
Ga0075459_100023613300006863AqueousMILQLNPMIPITRKSDGMKGYAFLVIDYSQEHYILFVC
Ga0105052_1103238033300007523FreshwaterMITQLNPMILIIHKESGVNGYAFLVIDYSQEHYLMFACSMDNGDIWI
Ga0102874_116580213300007546EstuarineMIPILRVSDGMEGYAFLVIDYSQEHNLLFTCAMDDGEIWTLSNHDIRF
Ga0102917_121262513300007590EstuarineMILQLNPMIPIKRVSDNMEGYAFLVIDYSQEHDLLFTC
Ga0102918_119542113300007593EstuarineMIVQLNPMIPIKRIKDDMEGYAFLVIDYSQEHDILFTCAMDDGE
Ga0102876_118146033300007642EstuarineMIPIIRVSDKMEGYAFLVIDYSQEHNLLFTCAMDDG
Ga0102902_120341213300007644EstuarineMNNNMLQLNPMIPIIRVSDKMEGYAFLVIDYSQEHNLY
Ga0102898_103025833300007658EstuarineMILQLNPMIPIKRVSDNMEGYAFLVIDYSQEHDLLFTCA
Ga0102899_108998823300007706EstuarineMILQLNPMIPIKRVSDDMEGYAFLVIDYSQEHDLLFTCAMDDGEIWTLN
Ga0102859_126914913300007708EstuarineMILQLDPMIPIYRVSDGLHGYAFLVIDYSQEHNLLFT
Ga0105748_1014157833300007992Estuary WaterMIPIVRVSDKMEGYAFMVIDYSQEHDLLFVCGMDDGEIWTLNN
Ga0114337_123106053300008262Freshwater, PlanktonMMLQLNPMIPIIRVSDNMEGYAFIVIDYSQEHDILFTCAMDNGEIWTLNN
Ga0114363_104810443300008266Freshwater, PlanktonMLQLNPMIPIYSIEHKMEGYAFLVIDYSQEHDLLFTCALDNGEISCKSSP*
Ga0114363_107691643300008266Freshwater, PlanktonMMLQLNPMLPIFRISDNMEGYAILVIDYSQEHDLLFTCAMDNGEIW
Ga0114363_111675533300008266Freshwater, PlanktonMIPIYSIEHKMEGYAFLVIDYSQEHDLLFTCALDNGEI
Ga0114363_114115753300008266Freshwater, PlanktonMMLQLNPMIPIFRISDNMEGYAILVIDYSQEHDLLFTCAMDNGEIW
Ga0114364_101002013300008267Freshwater, PlanktonMIPIVRVKDGMEGYAFLVIDYSQEHNLLFTCAMDDGEIWTL
Ga0114878_105316613300008339Freshwater LakeMLQLNPMIPIYSIEHKMEGYAFLVIDYSQEHDLLFTCALDNGEI
Ga0114876_115704413300008448Freshwater LakeMIPVFSIEHNMEGYAFLVIDYSQEHDLLFTVALDNGEIWT
Ga0102891_103121943300008950EstuarineMIPIVRVSDGLEGYAFLVIDYSQEHNLLFTCAMDDGKIWTL
Ga0114962_1069749613300009151Freshwater LakeMVTQLNPMIPIYRLSDKMEGYAFLVIDYSQEHNLLFT
Ga0114963_1032563713300009154Freshwater LakeMMLQLNPMIPIKRVSDGMEGYAFMVIDYSQEHDLLFTCAMDDGEIWTLNNKE
Ga0114977_1015611453300009158Freshwater LakeMILQLNPTLLIRRVSDKMSGYAFLIIDYSQEHDLLFTCAMQNG
Ga0114966_1075182523300009161Freshwater LakeMIPILRISDNMKGFAFILTDYSQEHDLLFTCAMDDGQIWTLS
Ga0105097_1090444223300009169Freshwater SedimentMLLQLNPMIPITRNSDQMKGFAFLVIDYAQEHNLMFTCAMDNG*
Ga0114959_1015232213300009182Freshwater LakeMIVQLNPMIPIFRKSDKMKGYAFLVIDYSQEHDLLFTCAMDN
Ga0114972_1029032413300009187Freshwater LakeMILQLNPMIPITRKSDGVKGYAFLVIDYSQEHYTLF
Ga0114964_10000127583300010157Freshwater LakeMLQLNPMIPIIRVSDKMEGYAFLVIDYSQEHDLLFTCAMDDG*
Ga0136644_1066712513300010334Freshwater LakeMIPIFSIEHNMEGYAFLVIDYSQEHDLLFTCALDN
Ga0129333_1146856913300010354Freshwater To Marine Saline GradientMLQLNPMIPVYSLLHQMEGYAFLVIDYSQEHDLLFTVALDNGEIWTL
Ga0133913_10478271103300010885Freshwater LakeMVTQLNPMIPIYRLSDKMEGYAFLVIDYSQEHNLLFTCAMTNGEI*
Ga0133913_1088104613300010885Freshwater LakeMIQLNPMIPITRKSDGVKGYAFLVIDYSQEHYTLFVCGMDDG
Ga0133913_1105385763300010885Freshwater LakeMMLQLNPMIPIKRVSDGMEGYAFMVIDYSQEHDLLFTCAMDDGEIWTLNNK
Ga0133913_1130971813300010885Freshwater LakeMILQLNPTMPIIRVSDGMKGYAFLVIDHSQELDLLYVCAMDNGEI
Ga0133913_1143185013300010885Freshwater LakeMILQLNPMIPITRKSDGVKGYAFLVIDYSQEHYTLFVCGMDDG
Ga0136712_101523933300012266FreshwaterMILQLNPMIPIMRVSDKMEGYAFLVIDYSQEHNLLFTCAMDDGEIWT
Ga0164292_1025169013300013005FreshwaterMAMIQLNPMIPIFRVSDKMEGYAFLVIDYSQEHNLLFTCA
Ga0119960_102400413300014811AquaticMMLQLNPMIPIFRVSDNMEGYAFLVIDYSQEHDLLFTCAMDAGLIVTGK
Ga0119960_105433713300014811AquaticMMLQLNPMIPIVRVSDKMEGFAFMVIDYSQEHNLLFVCGMDER*
Ga0181349_121273713300017778Freshwater LakeMLQLNPMIPIYRLSDGMEGYAFLVIDYSQEHNLLF
Ga0181349_127291733300017778Freshwater LakeMIVQLNPTIPIIRVSDKMNGYAFLIIDYSQEHNLLFVCGMDNGEIW
Ga0181348_115905123300017784Freshwater LakeMMLQLNPMIPIVRDSDGMKGYAMLVIDYSQEHDLLFTCAMD
Ga0181355_1003904133300017785Freshwater LakeMIVQLNPMIPIKRVSDNMEGYAFLVIDYSQEHDLLFTCAM
Ga0181355_113958413300017785Freshwater LakeMMLQLNPMIPIIRVSDNMEGYAFIVIDYSQEHDILFTCAMD
Ga0181359_114956433300019784Freshwater LakeMIVQLNPMIPIKRVSDNMEGYAFLVIDYSQEHDLSIYMCNG
Ga0207193_1020280113300020048Freshwater Lake SedimentMLQLNPTIPIIRISDGMKGYAFMVIDYSQEHNMDLVFVKYKS
Ga0211732_120113013300020141FreshwaterMILQLNPMIPITRKTDGMKGYAFLVIDYSQEHYTLFVCAMDDGD
Ga0211736_1103400813300020151FreshwaterMNNNMLQLNPMIPIVRVSDGLEGYAFLVIDYSQEHNLLFTCAMDNGEIWT
Ga0211734_1018431313300020159FreshwaterMNNNMLQLNPMIPIVRVSDGLEGYAFLVIDYSQEHN
Ga0211734_1092157923300020159FreshwaterMMLQLNPMIPILRTSDGMEGYAFLVIDYSQEHNLLFTCAMDD
Ga0211731_1103495933300020205FreshwaterMMLQLDPMLPIKRVSDNIEGYAFLIIDYSQEHDLLFTCAMDDGEIW
Ga0208224_103197223300020528FreshwaterMIIQLNPMIPIVRVSDNMEGYAFLLIDYSQEHNLLFTCAMD
Ga0194048_1020753613300021519Anoxic Zone FreshwaterMISIVRVKDKMEGYAFLVIDYSQEHNLLFTCAMDDGEIW
Ga0213922_108417823300021956FreshwaterMMTQLNPMIPIVRVSDKMEGYAFMVIDYSQEHDLLFVCG
Ga0222714_1052630533300021961Estuarine WaterMLQLNPMIPIVRVSDKMEGYAFLVIDYSQEHNILF
Ga0222713_1031312363300021962Estuarine WaterMLQLNPMIPIVRVSDGMEGYAFLVIDYSQEHNLLFTCAMDDGEIWTLSNK
Ga0222713_1033416643300021962Estuarine WaterMIPIVRVSDKMEGYAFLVIDYSQEHNILFTCAMDDGEIWTLS
Ga0222713_1059704413300021962Estuarine WaterMKIQNKTKMILQLNPMIPIVRVSDKMEGYAFLVIDYSQEHNLLFTCAMDDGQIWTLTNK
Ga0222712_1008987183300021963Estuarine WaterMMLQLEPMIPIKRVSDNMEGYAFLVIDYSQEHNLLFTCAMD
Ga0222712_1081701913300021963Estuarine WaterMIIQLNPMIPILRVSDKMEGYAFLVIDYSQEHDLLFTC
Ga0196901_100474013300022200AqueousMLQLNPMIPIFRVSDNMEGYAFLVIDYSQEHDLLFTCAMDDGQ
Ga0181351_101204413300022407Freshwater LakeMIIQLNPMIPIFRLSDNMEGYAFLVIDYSQEHNLLFTCAMDNG
Ga0255178_110901433300024298FreshwaterMGMMLQLNPMIPIIRVSDGMEGYAFLVIDYSQEHNLLFTCAMDDGEIWT
Ga0255169_103934613300024356FreshwaterMGMMLQLNPMIPIVRISDGMEGYAFLVIDYSQEHNLLFTC
Ga0256309_101465873300024566FreshwaterMIPITRKSDGVKGYAFLVIDYSQEHYTLFVCGMDDGDIWILDNREI
Ga0208499_105134023300025789FreshwaterMILQLNPMIPIVRVKDKMEGYAFLVLDYSQEHNLLFTCAMDDGEIWTLNNK
Ga0255071_100675313300027127FreshwaterMIPITRKSDGVKGYAFLVIDYSQEHYTLFVCGMDDGDIW
Ga0255069_103091223300027134FreshwaterMNNNMLQLNPMIPIVRVSDGLEGYAFLVIDYSQEHNLLFTCAMDNGEIWTLNN
Ga0255114_108129323300027145FreshwaterMILQLNPMIPITRKSDGMKGYAFLVIDYSQEHYILFVCG
Ga0255122_108953323300027595FreshwaterMLQLNPTLPIERRSDKMKGYAFAIIDYSQEHDLLF
Ga0209356_108208413300027644Freshwater LakeMIVQLNPMIPIKRVSDNMEGYAFLVIDYSQEHDLLFTCAMDNGEIWTLN
Ga0209087_106046513300027734Freshwater LakeMMLQLNPMIPIKRVSDGLEGYAFLVIDYSQEHDLLFTCAMDDGEIWT
Ga0209190_123673343300027736Freshwater LakeMMLQLNPMLPIIRVKDKMEGYAFMVIDYSQEHNLLFV
Ga0209107_1055868813300027797Freshwater And SedimentMLQLNPTIPIVRLSDGMKGFAFAIIDYSQEHDLLFICAMDDTEIWT
Ga0255254_105362733300028105FreshwaterMILQLNPMIPITRKSDGMKGYAFLVIDYSQEHYILFVCGMDNGDIWALT
Ga0256305_109272233300028108FreshwaterMMLQLNPMVPIKRISDGLEGYAFLVIDYSQEHDLLFTCAMDDGEIWTL
Ga0304730_117935223300028394Freshwater LakeMMLQLNPMIPIVRVSDKMEGFAFMVIDYSQEHNLLFVC
Ga0311339_1060037833300029999PalsaMIIQLDPFIPVYSIEYKMNGYAFLAIDYSQEHHILFTVALDNGEIWTIPSIG
Ga0315907_100000861513300031758FreshwaterMMLQLNPTIPIIRVSDNMKGYAFLVIDYSQEHDLMFTCAMDNGEIWTLKNS
Ga0315909_1055366513300031857FreshwaterMMLQLNPMIPIFRISDNMEGYAILVIDYSQEHDLLF
Ga0315904_1039290053300031951FreshwaterMMLQLNPMLPIFRISDNMEGYAILVIDYSQEHDLLFTCAMDNGEIWT
Ga0315294_1084715533300031952SedimentMIIQLNPMIPIKRISDEMEGYAFLVIDYSQEHNLLFTCAMDDGEIW
Ga0315906_1107189413300032050FreshwaterMMLQLNPMLPIFRISDNMEGYAILVIDYSQEHDLLFTCAMD
Ga0315902_1122116213300032093FreshwaterMIVQLNPMIPIKRISDNLEGYAFLVIDYSQEHDLLFTC
Ga0315903_1093776823300032116FreshwaterMLQLNPMIPIKRISDDMEGYAFLVIDYSQEHDLLF
Ga0315292_1059264033300032143SedimentMILQLNPMIPIVRDSDGMKGYAMLVIDYSQEHDLLFCCAMDNGEI
Ga0335396_1028741313300032462FreshwaterMITQLNPMIPIIHKESGVNGYAFLVIDYSQEHYLMFACSMDNGDIWI
Ga0316225_111525323300032675FreshwaterMILQLNPMIPIVRVKDKMEGYAFLVIDYSQEHNLLFTCAM
Ga0335025_0652851_355_5133300034096FreshwaterMMLQLNPMIPIKRVLDDLEGYAFLVIDYSQEHDLLFTCAMDNGEIWTLNNREL
Ga0335029_0345363_485_6403300034102FreshwaterMIIQLNPMIPIFRVSDNMEGYAFLVIDYSQEHNLLFTCAMDNGEIWTLSNK
Ga0335036_0184619_2_1123300034106FreshwaterMIPIFRVSDNMKGYAFLVIDYSQEHNLLFTCAMDDGE
Ga0335039_0048462_88_2643300034355FreshwaterMMLQLNPMIPIKRVLDDLEGYAFLVIDYSQEHDLLFTCAMDNGEIWTLNNRNSGSAKI
Ga0335064_0897758_403_5343300034357FreshwaterMIIQLNPMIPIFRVSDNMEGYAFLVIDYSQEHNLLFTCAMDNGE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.