| Basic Information | |
|---|---|
| Family ID | F105154 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MLQLNPMIPIIRVSDKMEGYAFLVIDYSQEHDLLFTCAMDDG |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 19.00 % |
| % of genes near scaffold ends (potentially truncated) | 91.00 % |
| % of genes from short scaffolds (< 2000 bps) | 85.00 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (16.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.86% Coil/Unstructured: 67.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF12705 | PDDEXK_1 | 9.00 |
| PF02562 | PhoH | 5.00 |
| PF01223 | Endonuclease_NS | 3.00 |
| PF13391 | HNH_2 | 1.00 |
| PF00041 | fn3 | 1.00 |
| PF00145 | DNA_methylase | 1.00 |
| PF00149 | Metallophos | 1.00 |
| PF08800 | VirE_N | 1.00 |
| PF10269 | Tmemb_185A | 1.00 |
| PF02151 | UVR | 1.00 |
| PF00216 | Bac_DNA_binding | 1.00 |
| PF00085 | Thioredoxin | 1.00 |
| PF13506 | Glyco_transf_21 | 1.00 |
| PF06067 | DUF932 | 1.00 |
| PF05118 | Asp_Arg_Hydrox | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 5.00 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 5.00 |
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 3.00 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.00 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.00 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.00 % |
| All Organisms | root | All Organisms | 42.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000928|OpTDRAFT_10324475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 586 | Open in IMG/M |
| 3300002408|B570J29032_108769569 | Not Available | 506 | Open in IMG/M |
| 3300005525|Ga0068877_10199059 | Not Available | 1200 | Open in IMG/M |
| 3300005527|Ga0068876_10493157 | Not Available | 673 | Open in IMG/M |
| 3300005662|Ga0078894_11297429 | Not Available | 612 | Open in IMG/M |
| 3300005805|Ga0079957_1335786 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006484|Ga0070744_10209657 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006863|Ga0075459_1000236 | Not Available | 8298 | Open in IMG/M |
| 3300007523|Ga0105052_11032380 | Not Available | 510 | Open in IMG/M |
| 3300007546|Ga0102874_1165802 | Not Available | 684 | Open in IMG/M |
| 3300007590|Ga0102917_1212625 | Not Available | 674 | Open in IMG/M |
| 3300007593|Ga0102918_1195421 | Not Available | 615 | Open in IMG/M |
| 3300007642|Ga0102876_1181460 | Not Available | 560 | Open in IMG/M |
| 3300007644|Ga0102902_1203412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300007658|Ga0102898_1030258 | Not Available | 1212 | Open in IMG/M |
| 3300007706|Ga0102899_1089988 | Not Available | 744 | Open in IMG/M |
| 3300007708|Ga0102859_1269149 | Not Available | 513 | Open in IMG/M |
| 3300007992|Ga0105748_10141578 | Not Available | 982 | Open in IMG/M |
| 3300008262|Ga0114337_1231060 | All Organisms → Viruses → Predicted Viral | 1333 | Open in IMG/M |
| 3300008266|Ga0114363_1048104 | Not Available | 3015 | Open in IMG/M |
| 3300008266|Ga0114363_1076916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus | 1253 | Open in IMG/M |
| 3300008266|Ga0114363_1116755 | All Organisms → Viruses → Predicted Viral | 1679 | Open in IMG/M |
| 3300008266|Ga0114363_1141157 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
| 3300008267|Ga0114364_1010020 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Aquirufa → Aquirufa lenticrescens | 4399 | Open in IMG/M |
| 3300008339|Ga0114878_1053166 | All Organisms → Viruses → Predicted Viral | 1709 | Open in IMG/M |
| 3300008448|Ga0114876_1157044 | Not Available | 822 | Open in IMG/M |
| 3300008950|Ga0102891_1031219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1681 | Open in IMG/M |
| 3300009151|Ga0114962_10697496 | Not Available | 519 | Open in IMG/M |
| 3300009154|Ga0114963_10325637 | Not Available | 849 | Open in IMG/M |
| 3300009158|Ga0114977_10156114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1356 | Open in IMG/M |
| 3300009161|Ga0114966_10751825 | Not Available | 529 | Open in IMG/M |
| 3300009169|Ga0105097_10904442 | Not Available | 507 | Open in IMG/M |
| 3300009182|Ga0114959_10152322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1228 | Open in IMG/M |
| 3300009187|Ga0114972_10290324 | Not Available | 973 | Open in IMG/M |
| 3300010157|Ga0114964_10000127 | Not Available | 56631 | Open in IMG/M |
| 3300010334|Ga0136644_10667125 | Not Available | 567 | Open in IMG/M |
| 3300010354|Ga0129333_11468569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriales incertae sedis → Microseira → Microseira wollei | 559 | Open in IMG/M |
| 3300010885|Ga0133913_10478271 | Not Available | 3284 | Open in IMG/M |
| 3300010885|Ga0133913_10881046 | All Organisms → Viruses → Predicted Viral | 2326 | Open in IMG/M |
| 3300010885|Ga0133913_11053857 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2098 | Open in IMG/M |
| 3300010885|Ga0133913_11309718 | Not Available | 1849 | Open in IMG/M |
| 3300010885|Ga0133913_11431850 | All Organisms → Viruses → Predicted Viral | 1755 | Open in IMG/M |
| 3300012266|Ga0136712_1015239 | Not Available | 844 | Open in IMG/M |
| 3300013005|Ga0164292_10251690 | Not Available | 1230 | Open in IMG/M |
| 3300014811|Ga0119960_1024004 | Not Available | 820 | Open in IMG/M |
| 3300014811|Ga0119960_1054337 | Not Available | 671 | Open in IMG/M |
| 3300017778|Ga0181349_1212737 | Not Available | 663 | Open in IMG/M |
| 3300017778|Ga0181349_1272917 | Not Available | 556 | Open in IMG/M |
| 3300017784|Ga0181348_1159051 | Not Available | 840 | Open in IMG/M |
| 3300017785|Ga0181355_1003904 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Rufibacter → unclassified Rufibacter → Rufibacter sp. SYSU D00433 | 6614 | Open in IMG/M |
| 3300017785|Ga0181355_1139584 | Not Available | 983 | Open in IMG/M |
| 3300019784|Ga0181359_1149564 | Not Available | 802 | Open in IMG/M |
| 3300020048|Ga0207193_1020280 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 8375 | Open in IMG/M |
| 3300020141|Ga0211732_1201130 | Not Available | 935 | Open in IMG/M |
| 3300020151|Ga0211736_11034008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1208 | Open in IMG/M |
| 3300020159|Ga0211734_10184313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
| 3300020159|Ga0211734_10921579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300020205|Ga0211731_11034959 | Not Available | 833 | Open in IMG/M |
| 3300020528|Ga0208224_1031972 | Not Available | 690 | Open in IMG/M |
| 3300021519|Ga0194048_10207536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300021956|Ga0213922_1084178 | Not Available | 658 | Open in IMG/M |
| 3300021961|Ga0222714_10526305 | Not Available | 602 | Open in IMG/M |
| 3300021962|Ga0222713_10313123 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 995 | Open in IMG/M |
| 3300021962|Ga0222713_10334166 | Not Available | 953 | Open in IMG/M |
| 3300021962|Ga0222713_10597044 | Not Available | 645 | Open in IMG/M |
| 3300021963|Ga0222712_10089871 | All Organisms → cellular organisms → Bacteria | 2173 | Open in IMG/M |
| 3300021963|Ga0222712_10817019 | Not Available | 512 | Open in IMG/M |
| 3300022200|Ga0196901_1004740 | All Organisms → cellular organisms → Bacteria | 6135 | Open in IMG/M |
| 3300022407|Ga0181351_1012044 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium aciduliphilum | 3535 | Open in IMG/M |
| 3300024298|Ga0255178_1109014 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 505 | Open in IMG/M |
| 3300024356|Ga0255169_1039346 | Not Available | 835 | Open in IMG/M |
| 3300024566|Ga0256309_1014658 | All Organisms → Viruses → Predicted Viral | 2140 | Open in IMG/M |
| 3300025789|Ga0208499_1051340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
| 3300027127|Ga0255071_1006753 | All Organisms → Viruses → Predicted Viral | 1969 | Open in IMG/M |
| 3300027134|Ga0255069_1030912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300027145|Ga0255114_1081293 | Not Available | 554 | Open in IMG/M |
| 3300027595|Ga0255122_1089533 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 504 | Open in IMG/M |
| 3300027644|Ga0209356_1082084 | Not Available | 958 | Open in IMG/M |
| 3300027734|Ga0209087_1060465 | All Organisms → Viruses → Predicted Viral | 1699 | Open in IMG/M |
| 3300027736|Ga0209190_1236733 | Not Available | 730 | Open in IMG/M |
| 3300027797|Ga0209107_10558688 | Not Available | 501 | Open in IMG/M |
| 3300028105|Ga0255254_1053627 | Not Available | 815 | Open in IMG/M |
| 3300028108|Ga0256305_1092722 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Muribaculaceae → unclassified Muribaculaceae → Muribaculaceae bacterium Isolate-007 (NCI) | 732 | Open in IMG/M |
| 3300028394|Ga0304730_1179352 | Not Available | 822 | Open in IMG/M |
| 3300029999|Ga0311339_10600378 | Not Available | 1096 | Open in IMG/M |
| 3300031758|Ga0315907_10000086 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 126523 | Open in IMG/M |
| 3300031857|Ga0315909_10553665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
| 3300031951|Ga0315904_10392900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus | 1260 | Open in IMG/M |
| 3300031952|Ga0315294_10847155 | Not Available | 781 | Open in IMG/M |
| 3300032050|Ga0315906_11071894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus | 598 | Open in IMG/M |
| 3300032093|Ga0315902_11221162 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300032116|Ga0315903_10937768 | Not Available | 614 | Open in IMG/M |
| 3300032143|Ga0315292_10592640 | Not Available | 934 | Open in IMG/M |
| 3300032462|Ga0335396_10287413 | Not Available | 1073 | Open in IMG/M |
| 3300032675|Ga0316225_1115253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 894 | Open in IMG/M |
| 3300034096|Ga0335025_0652851 | Not Available | 514 | Open in IMG/M |
| 3300034102|Ga0335029_0345363 | Not Available | 920 | Open in IMG/M |
| 3300034106|Ga0335036_0184619 | Not Available | 1459 | Open in IMG/M |
| 3300034355|Ga0335039_0048462 | All Organisms → Viruses → Predicted Viral | 2566 | Open in IMG/M |
| 3300034357|Ga0335064_0897758 | Not Available | 534 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.00% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 9.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 9.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.00% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.00% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 2.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.00% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.00% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.00% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.00% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.00% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.00% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.00% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 1.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007593 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012266 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020528 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300024356 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d | Environmental | Open in IMG/M |
| 3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes) | Environmental | Open in IMG/M |
| 3300027127 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h | Environmental | Open in IMG/M |
| 3300027134 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027595 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300028105 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
| 3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
| 3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OpTDRAFT_103244752 | 3300000928 | Freshwater And Marine | MLQLNPMIPIVRVSDKMEGFAFMVIDYSQEHNLLFVCGMDDGEIWTL |
| B570J29032_1087695692 | 3300002408 | Freshwater | MILQLNPMIPILRVSDGMEGYAFLVIDYSQEHNLLFTCAMDD |
| Ga0068877_101990591 | 3300005525 | Freshwater Lake | MMLQLNPMLPIIRNSDGMKGFAFLVIDYSQEHDLLFTCAMDDGEIWTLSNKE |
| Ga0068876_104931571 | 3300005527 | Freshwater Lake | MLQLNPMIPIYSIEHKMEGYAFLVIDYSQEHDLLF |
| Ga0078894_112974291 | 3300005662 | Freshwater Lake | MMLQLNPMLPIVRVSDGMEGYAFLVIDYSQEHYTLFTCAMDNGEI |
| Ga0079957_13357862 | 3300005805 | Lake | MIPVKRISDNMKGYAFLVIDYSQEHDLLFTCAMDDG |
| Ga0070744_102096573 | 3300006484 | Estuarine | MIPIIRVSDKMEGYAFLVIDYSQEHNLLFTCAMDD |
| Ga0075459_10002361 | 3300006863 | Aqueous | MILQLNPMIPITRKSDGMKGYAFLVIDYSQEHYILFVC |
| Ga0105052_110323803 | 3300007523 | Freshwater | MITQLNPMILIIHKESGVNGYAFLVIDYSQEHYLMFACSMDNGDIWI |
| Ga0102874_11658021 | 3300007546 | Estuarine | MIPILRVSDGMEGYAFLVIDYSQEHNLLFTCAMDDGEIWTLSNHDIRF |
| Ga0102917_12126251 | 3300007590 | Estuarine | MILQLNPMIPIKRVSDNMEGYAFLVIDYSQEHDLLFTC |
| Ga0102918_11954211 | 3300007593 | Estuarine | MIVQLNPMIPIKRIKDDMEGYAFLVIDYSQEHDILFTCAMDDGE |
| Ga0102876_11814603 | 3300007642 | Estuarine | MIPIIRVSDKMEGYAFLVIDYSQEHNLLFTCAMDDG |
| Ga0102902_12034121 | 3300007644 | Estuarine | MNNNMLQLNPMIPIIRVSDKMEGYAFLVIDYSQEHNLY |
| Ga0102898_10302583 | 3300007658 | Estuarine | MILQLNPMIPIKRVSDNMEGYAFLVIDYSQEHDLLFTCA |
| Ga0102899_10899882 | 3300007706 | Estuarine | MILQLNPMIPIKRVSDDMEGYAFLVIDYSQEHDLLFTCAMDDGEIWTLN |
| Ga0102859_12691491 | 3300007708 | Estuarine | MILQLDPMIPIYRVSDGLHGYAFLVIDYSQEHNLLFT |
| Ga0105748_101415783 | 3300007992 | Estuary Water | MIPIVRVSDKMEGYAFMVIDYSQEHDLLFVCGMDDGEIWTLNN |
| Ga0114337_12310605 | 3300008262 | Freshwater, Plankton | MMLQLNPMIPIIRVSDNMEGYAFIVIDYSQEHDILFTCAMDNGEIWTLNN |
| Ga0114363_10481044 | 3300008266 | Freshwater, Plankton | MLQLNPMIPIYSIEHKMEGYAFLVIDYSQEHDLLFTCALDNGEISCKSSP* |
| Ga0114363_10769164 | 3300008266 | Freshwater, Plankton | MMLQLNPMLPIFRISDNMEGYAILVIDYSQEHDLLFTCAMDNGEIW |
| Ga0114363_11167553 | 3300008266 | Freshwater, Plankton | MIPIYSIEHKMEGYAFLVIDYSQEHDLLFTCALDNGEI |
| Ga0114363_11411575 | 3300008266 | Freshwater, Plankton | MMLQLNPMIPIFRISDNMEGYAILVIDYSQEHDLLFTCAMDNGEIW |
| Ga0114364_10100201 | 3300008267 | Freshwater, Plankton | MIPIVRVKDGMEGYAFLVIDYSQEHNLLFTCAMDDGEIWTL |
| Ga0114878_10531661 | 3300008339 | Freshwater Lake | MLQLNPMIPIYSIEHKMEGYAFLVIDYSQEHDLLFTCALDNGEI |
| Ga0114876_11570441 | 3300008448 | Freshwater Lake | MIPVFSIEHNMEGYAFLVIDYSQEHDLLFTVALDNGEIWT |
| Ga0102891_10312194 | 3300008950 | Estuarine | MIPIVRVSDGLEGYAFLVIDYSQEHNLLFTCAMDDGKIWTL |
| Ga0114962_106974961 | 3300009151 | Freshwater Lake | MVTQLNPMIPIYRLSDKMEGYAFLVIDYSQEHNLLFT |
| Ga0114963_103256371 | 3300009154 | Freshwater Lake | MMLQLNPMIPIKRVSDGMEGYAFMVIDYSQEHDLLFTCAMDDGEIWTLNNKE |
| Ga0114977_101561145 | 3300009158 | Freshwater Lake | MILQLNPTLLIRRVSDKMSGYAFLIIDYSQEHDLLFTCAMQNG |
| Ga0114966_107518252 | 3300009161 | Freshwater Lake | MIPILRISDNMKGFAFILTDYSQEHDLLFTCAMDDGQIWTLS |
| Ga0105097_109044422 | 3300009169 | Freshwater Sediment | MLLQLNPMIPITRNSDQMKGFAFLVIDYAQEHNLMFTCAMDNG* |
| Ga0114959_101523221 | 3300009182 | Freshwater Lake | MIVQLNPMIPIFRKSDKMKGYAFLVIDYSQEHDLLFTCAMDN |
| Ga0114972_102903241 | 3300009187 | Freshwater Lake | MILQLNPMIPITRKSDGVKGYAFLVIDYSQEHYTLF |
| Ga0114964_1000012758 | 3300010157 | Freshwater Lake | MLQLNPMIPIIRVSDKMEGYAFLVIDYSQEHDLLFTCAMDDG* |
| Ga0136644_106671251 | 3300010334 | Freshwater Lake | MIPIFSIEHNMEGYAFLVIDYSQEHDLLFTCALDN |
| Ga0129333_114685691 | 3300010354 | Freshwater To Marine Saline Gradient | MLQLNPMIPVYSLLHQMEGYAFLVIDYSQEHDLLFTVALDNGEIWTL |
| Ga0133913_1047827110 | 3300010885 | Freshwater Lake | MVTQLNPMIPIYRLSDKMEGYAFLVIDYSQEHNLLFTCAMTNGEI* |
| Ga0133913_108810461 | 3300010885 | Freshwater Lake | MIQLNPMIPITRKSDGVKGYAFLVIDYSQEHYTLFVCGMDDG |
| Ga0133913_110538576 | 3300010885 | Freshwater Lake | MMLQLNPMIPIKRVSDGMEGYAFMVIDYSQEHDLLFTCAMDDGEIWTLNNK |
| Ga0133913_113097181 | 3300010885 | Freshwater Lake | MILQLNPTMPIIRVSDGMKGYAFLVIDHSQELDLLYVCAMDNGEI |
| Ga0133913_114318501 | 3300010885 | Freshwater Lake | MILQLNPMIPITRKSDGVKGYAFLVIDYSQEHYTLFVCGMDDG |
| Ga0136712_10152393 | 3300012266 | Freshwater | MILQLNPMIPIMRVSDKMEGYAFLVIDYSQEHNLLFTCAMDDGEIWT |
| Ga0164292_102516901 | 3300013005 | Freshwater | MAMIQLNPMIPIFRVSDKMEGYAFLVIDYSQEHNLLFTCA |
| Ga0119960_10240041 | 3300014811 | Aquatic | MMLQLNPMIPIFRVSDNMEGYAFLVIDYSQEHDLLFTCAMDAGLIVTGK |
| Ga0119960_10543371 | 3300014811 | Aquatic | MMLQLNPMIPIVRVSDKMEGFAFMVIDYSQEHNLLFVCGMDER* |
| Ga0181349_12127371 | 3300017778 | Freshwater Lake | MLQLNPMIPIYRLSDGMEGYAFLVIDYSQEHNLLF |
| Ga0181349_12729173 | 3300017778 | Freshwater Lake | MIVQLNPTIPIIRVSDKMNGYAFLIIDYSQEHNLLFVCGMDNGEIW |
| Ga0181348_11590512 | 3300017784 | Freshwater Lake | MMLQLNPMIPIVRDSDGMKGYAMLVIDYSQEHDLLFTCAMD |
| Ga0181355_100390413 | 3300017785 | Freshwater Lake | MIVQLNPMIPIKRVSDNMEGYAFLVIDYSQEHDLLFTCAM |
| Ga0181355_11395841 | 3300017785 | Freshwater Lake | MMLQLNPMIPIIRVSDNMEGYAFIVIDYSQEHDILFTCAMD |
| Ga0181359_11495643 | 3300019784 | Freshwater Lake | MIVQLNPMIPIKRVSDNMEGYAFLVIDYSQEHDLSIYMCNG |
| Ga0207193_102028011 | 3300020048 | Freshwater Lake Sediment | MLQLNPTIPIIRISDGMKGYAFMVIDYSQEHNMDLVFVKYKS |
| Ga0211732_12011301 | 3300020141 | Freshwater | MILQLNPMIPITRKTDGMKGYAFLVIDYSQEHYTLFVCAMDDGD |
| Ga0211736_110340081 | 3300020151 | Freshwater | MNNNMLQLNPMIPIVRVSDGLEGYAFLVIDYSQEHNLLFTCAMDNGEIWT |
| Ga0211734_101843131 | 3300020159 | Freshwater | MNNNMLQLNPMIPIVRVSDGLEGYAFLVIDYSQEHN |
| Ga0211734_109215792 | 3300020159 | Freshwater | MMLQLNPMIPILRTSDGMEGYAFLVIDYSQEHNLLFTCAMDD |
| Ga0211731_110349593 | 3300020205 | Freshwater | MMLQLDPMLPIKRVSDNIEGYAFLIIDYSQEHDLLFTCAMDDGEIW |
| Ga0208224_10319722 | 3300020528 | Freshwater | MIIQLNPMIPIVRVSDNMEGYAFLLIDYSQEHNLLFTCAMD |
| Ga0194048_102075361 | 3300021519 | Anoxic Zone Freshwater | MISIVRVKDKMEGYAFLVIDYSQEHNLLFTCAMDDGEIW |
| Ga0213922_10841782 | 3300021956 | Freshwater | MMTQLNPMIPIVRVSDKMEGYAFMVIDYSQEHDLLFVCG |
| Ga0222714_105263053 | 3300021961 | Estuarine Water | MLQLNPMIPIVRVSDKMEGYAFLVIDYSQEHNILF |
| Ga0222713_103131236 | 3300021962 | Estuarine Water | MLQLNPMIPIVRVSDGMEGYAFLVIDYSQEHNLLFTCAMDDGEIWTLSNK |
| Ga0222713_103341664 | 3300021962 | Estuarine Water | MIPIVRVSDKMEGYAFLVIDYSQEHNILFTCAMDDGEIWTLS |
| Ga0222713_105970441 | 3300021962 | Estuarine Water | MKIQNKTKMILQLNPMIPIVRVSDKMEGYAFLVIDYSQEHNLLFTCAMDDGQIWTLTNK |
| Ga0222712_100898718 | 3300021963 | Estuarine Water | MMLQLEPMIPIKRVSDNMEGYAFLVIDYSQEHNLLFTCAMD |
| Ga0222712_108170191 | 3300021963 | Estuarine Water | MIIQLNPMIPILRVSDKMEGYAFLVIDYSQEHDLLFTC |
| Ga0196901_10047401 | 3300022200 | Aqueous | MLQLNPMIPIFRVSDNMEGYAFLVIDYSQEHDLLFTCAMDDGQ |
| Ga0181351_10120441 | 3300022407 | Freshwater Lake | MIIQLNPMIPIFRLSDNMEGYAFLVIDYSQEHNLLFTCAMDNG |
| Ga0255178_11090143 | 3300024298 | Freshwater | MGMMLQLNPMIPIIRVSDGMEGYAFLVIDYSQEHNLLFTCAMDDGEIWT |
| Ga0255169_10393461 | 3300024356 | Freshwater | MGMMLQLNPMIPIVRISDGMEGYAFLVIDYSQEHNLLFTC |
| Ga0256309_10146587 | 3300024566 | Freshwater | MIPITRKSDGVKGYAFLVIDYSQEHYTLFVCGMDDGDIWILDNREI |
| Ga0208499_10513402 | 3300025789 | Freshwater | MILQLNPMIPIVRVKDKMEGYAFLVLDYSQEHNLLFTCAMDDGEIWTLNNK |
| Ga0255071_10067531 | 3300027127 | Freshwater | MIPITRKSDGVKGYAFLVIDYSQEHYTLFVCGMDDGDIW |
| Ga0255069_10309122 | 3300027134 | Freshwater | MNNNMLQLNPMIPIVRVSDGLEGYAFLVIDYSQEHNLLFTCAMDNGEIWTLNN |
| Ga0255114_10812932 | 3300027145 | Freshwater | MILQLNPMIPITRKSDGMKGYAFLVIDYSQEHYILFVCG |
| Ga0255122_10895332 | 3300027595 | Freshwater | MLQLNPTLPIERRSDKMKGYAFAIIDYSQEHDLLF |
| Ga0209356_10820841 | 3300027644 | Freshwater Lake | MIVQLNPMIPIKRVSDNMEGYAFLVIDYSQEHDLLFTCAMDNGEIWTLN |
| Ga0209087_10604651 | 3300027734 | Freshwater Lake | MMLQLNPMIPIKRVSDGLEGYAFLVIDYSQEHDLLFTCAMDDGEIWT |
| Ga0209190_12367334 | 3300027736 | Freshwater Lake | MMLQLNPMLPIIRVKDKMEGYAFMVIDYSQEHNLLFV |
| Ga0209107_105586881 | 3300027797 | Freshwater And Sediment | MLQLNPTIPIVRLSDGMKGFAFAIIDYSQEHDLLFICAMDDTEIWT |
| Ga0255254_10536273 | 3300028105 | Freshwater | MILQLNPMIPITRKSDGMKGYAFLVIDYSQEHYILFVCGMDNGDIWALT |
| Ga0256305_10927223 | 3300028108 | Freshwater | MMLQLNPMVPIKRISDGLEGYAFLVIDYSQEHDLLFTCAMDDGEIWTL |
| Ga0304730_11793522 | 3300028394 | Freshwater Lake | MMLQLNPMIPIVRVSDKMEGFAFMVIDYSQEHNLLFVC |
| Ga0311339_106003783 | 3300029999 | Palsa | MIIQLDPFIPVYSIEYKMNGYAFLAIDYSQEHHILFTVALDNGEIWTIPSIG |
| Ga0315907_10000086151 | 3300031758 | Freshwater | MMLQLNPTIPIIRVSDNMKGYAFLVIDYSQEHDLMFTCAMDNGEIWTLKNS |
| Ga0315909_105536651 | 3300031857 | Freshwater | MMLQLNPMIPIFRISDNMEGYAILVIDYSQEHDLLF |
| Ga0315904_103929005 | 3300031951 | Freshwater | MMLQLNPMLPIFRISDNMEGYAILVIDYSQEHDLLFTCAMDNGEIWT |
| Ga0315294_108471553 | 3300031952 | Sediment | MIIQLNPMIPIKRISDEMEGYAFLVIDYSQEHNLLFTCAMDDGEIW |
| Ga0315906_110718941 | 3300032050 | Freshwater | MMLQLNPMLPIFRISDNMEGYAILVIDYSQEHDLLFTCAMD |
| Ga0315902_112211621 | 3300032093 | Freshwater | MIVQLNPMIPIKRISDNLEGYAFLVIDYSQEHDLLFTC |
| Ga0315903_109377682 | 3300032116 | Freshwater | MLQLNPMIPIKRISDDMEGYAFLVIDYSQEHDLLF |
| Ga0315292_105926403 | 3300032143 | Sediment | MILQLNPMIPIVRDSDGMKGYAMLVIDYSQEHDLLFCCAMDNGEI |
| Ga0335396_102874131 | 3300032462 | Freshwater | MITQLNPMIPIIHKESGVNGYAFLVIDYSQEHYLMFACSMDNGDIWI |
| Ga0316225_11152532 | 3300032675 | Freshwater | MILQLNPMIPIVRVKDKMEGYAFLVIDYSQEHNLLFTCAM |
| Ga0335025_0652851_355_513 | 3300034096 | Freshwater | MMLQLNPMIPIKRVLDDLEGYAFLVIDYSQEHDLLFTCAMDNGEIWTLNNREL |
| Ga0335029_0345363_485_640 | 3300034102 | Freshwater | MIIQLNPMIPIFRVSDNMEGYAFLVIDYSQEHNLLFTCAMDNGEIWTLSNK |
| Ga0335036_0184619_2_112 | 3300034106 | Freshwater | MIPIFRVSDNMKGYAFLVIDYSQEHNLLFTCAMDDGE |
| Ga0335039_0048462_88_264 | 3300034355 | Freshwater | MMLQLNPMIPIKRVLDDLEGYAFLVIDYSQEHDLLFTCAMDNGEIWTLNNRNSGSAKI |
| Ga0335064_0897758_403_534 | 3300034357 | Freshwater | MIIQLNPMIPIFRVSDNMEGYAFLVIDYSQEHNLLFTCAMDNGE |
| ⦗Top⦘ |