| Basic Information | |
|---|---|
| Family ID | F105119 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSAVAVPARAQRRNVLASVWAFVRRHVLTVYSILFFAYLLLPI |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 96.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.00 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (24.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 86.00 |
| PF08402 | TOBE_2 | 4.00 |
| PF13416 | SBP_bac_8 | 3.00 |
| PF13343 | SBP_bac_6 | 2.00 |
| PF13347 | MFS_2 | 1.00 |
| PF13404 | HTH_AsnC-type | 1.00 |
| PF04167 | DUF402 | 1.00 |
| PF00342 | PGI | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.00 % |
| All Organisms | root | All Organisms | 42.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000043|ARcpr5yngRDRAFT_c010505 | Not Available | 785 | Open in IMG/M |
| 3300000956|JGI10216J12902_100032866 | Not Available | 652 | Open in IMG/M |
| 3300000956|JGI10216J12902_107188319 | Not Available | 673 | Open in IMG/M |
| 3300001305|C688J14111_10067847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1082 | Open in IMG/M |
| 3300001305|C688J14111_10098288 | Not Available | 891 | Open in IMG/M |
| 3300005174|Ga0066680_10600455 | Not Available | 689 | Open in IMG/M |
| 3300005331|Ga0070670_100751360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 879 | Open in IMG/M |
| 3300005332|Ga0066388_104047216 | Not Available | 747 | Open in IMG/M |
| 3300005340|Ga0070689_101878821 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005441|Ga0070700_101156652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 644 | Open in IMG/M |
| 3300005445|Ga0070708_102046979 | Not Available | 530 | Open in IMG/M |
| 3300005456|Ga0070678_100620989 | Not Available | 967 | Open in IMG/M |
| 3300005458|Ga0070681_11250154 | Not Available | 665 | Open in IMG/M |
| 3300005540|Ga0066697_10275096 | Not Available | 994 | Open in IMG/M |
| 3300005564|Ga0070664_102022923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 547 | Open in IMG/M |
| 3300005713|Ga0066905_100681424 | Not Available | 880 | Open in IMG/M |
| 3300005764|Ga0066903_100544357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1987 | Open in IMG/M |
| 3300006031|Ga0066651_10528487 | Not Available | 625 | Open in IMG/M |
| 3300006578|Ga0074059_12090251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 851 | Open in IMG/M |
| 3300006579|Ga0074054_11996612 | Not Available | 580 | Open in IMG/M |
| 3300006580|Ga0074049_13037236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1153 | Open in IMG/M |
| 3300006604|Ga0074060_11820646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 519 | Open in IMG/M |
| 3300006791|Ga0066653_10019198 | All Organisms → cellular organisms → Bacteria | 2536 | Open in IMG/M |
| 3300006794|Ga0066658_10351278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 789 | Open in IMG/M |
| 3300006969|Ga0075419_10584063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 783 | Open in IMG/M |
| 3300009011|Ga0105251_10524236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
| 3300009177|Ga0105248_10655017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1185 | Open in IMG/M |
| 3300010043|Ga0126380_12232704 | Not Available | 507 | Open in IMG/M |
| 3300010117|Ga0127449_1001409 | Not Available | 547 | Open in IMG/M |
| 3300010326|Ga0134065_10488026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 511 | Open in IMG/M |
| 3300010336|Ga0134071_10607221 | Not Available | 572 | Open in IMG/M |
| 3300010359|Ga0126376_11668687 | Not Available | 671 | Open in IMG/M |
| 3300010375|Ga0105239_10116859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2960 | Open in IMG/M |
| 3300012198|Ga0137364_10181187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1537 | Open in IMG/M |
| 3300012201|Ga0137365_10554044 | Not Available | 844 | Open in IMG/M |
| 3300012206|Ga0137380_11586158 | Not Available | 539 | Open in IMG/M |
| 3300012210|Ga0137378_10066033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3277 | Open in IMG/M |
| 3300012210|Ga0137378_11350096 | Not Available | 628 | Open in IMG/M |
| 3300012211|Ga0137377_11455678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 612 | Open in IMG/M |
| 3300012212|Ga0150985_115214516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1285 | Open in IMG/M |
| 3300012488|Ga0157343_1024958 | Not Available | 567 | Open in IMG/M |
| 3300012499|Ga0157350_1044376 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012897|Ga0157285_10270098 | Not Available | 566 | Open in IMG/M |
| 3300012911|Ga0157301_10245587 | Not Available | 627 | Open in IMG/M |
| 3300012960|Ga0164301_11208775 | Not Available | 608 | Open in IMG/M |
| 3300012984|Ga0164309_11493371 | Not Available | 578 | Open in IMG/M |
| 3300012986|Ga0164304_10222675 | Not Available | 1247 | Open in IMG/M |
| 3300013297|Ga0157378_12737509 | Not Available | 546 | Open in IMG/M |
| 3300014166|Ga0134079_10189629 | Not Available | 855 | Open in IMG/M |
| 3300014325|Ga0163163_12064705 | Not Available | 630 | Open in IMG/M |
| 3300014497|Ga0182008_10407456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 731 | Open in IMG/M |
| 3300014745|Ga0157377_11317523 | Not Available | 565 | Open in IMG/M |
| 3300014969|Ga0157376_11743577 | Not Available | 658 | Open in IMG/M |
| 3300015372|Ga0132256_103695596 | Not Available | 515 | Open in IMG/M |
| 3300015374|Ga0132255_101182710 | Not Available | 1151 | Open in IMG/M |
| 3300017947|Ga0187785_10608196 | Not Available | 562 | Open in IMG/M |
| 3300018066|Ga0184617_1091682 | Not Available | 838 | Open in IMG/M |
| 3300018433|Ga0066667_10014568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3950 | Open in IMG/M |
| 3300018433|Ga0066667_10783460 | Not Available | 808 | Open in IMG/M |
| 3300018482|Ga0066669_11731562 | Not Available | 575 | Open in IMG/M |
| 3300019867|Ga0193704_1040230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 932 | Open in IMG/M |
| 3300019877|Ga0193722_1042757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1159 | Open in IMG/M |
| 3300019877|Ga0193722_1148479 | Not Available | 513 | Open in IMG/M |
| 3300020004|Ga0193755_1086450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1002 | Open in IMG/M |
| 3300021078|Ga0210381_10087802 | Not Available | 993 | Open in IMG/M |
| 3300022694|Ga0222623_10007784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3837 | Open in IMG/M |
| 3300024219|Ga0247665_1046381 | Not Available | 598 | Open in IMG/M |
| 3300025911|Ga0207654_10035652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2773 | Open in IMG/M |
| 3300025911|Ga0207654_10493648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 864 | Open in IMG/M |
| 3300025919|Ga0207657_11455345 | Not Available | 513 | Open in IMG/M |
| 3300025926|Ga0207659_10388810 | Not Available | 1165 | Open in IMG/M |
| 3300025930|Ga0207701_11406085 | Not Available | 568 | Open in IMG/M |
| 3300025938|Ga0207704_11383033 | Not Available | 603 | Open in IMG/M |
| 3300025939|Ga0207665_10277086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1247 | Open in IMG/M |
| 3300025944|Ga0207661_10656178 | Not Available | 964 | Open in IMG/M |
| 3300025944|Ga0207661_11079878 | Not Available | 739 | Open in IMG/M |
| 3300026078|Ga0207702_11474514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
| 3300026088|Ga0207641_12214445 | Not Available | 550 | Open in IMG/M |
| 3300026306|Ga0209468_1060212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1279 | Open in IMG/M |
| 3300026323|Ga0209472_1072051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1424 | Open in IMG/M |
| 3300026342|Ga0209057_1194134 | Not Available | 579 | Open in IMG/M |
| 3300026827|Ga0207591_101279 | Not Available | 936 | Open in IMG/M |
| 3300028708|Ga0307295_10162049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 624 | Open in IMG/M |
| 3300028717|Ga0307298_10003331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3800 | Open in IMG/M |
| 3300028718|Ga0307307_10092661 | Not Available | 916 | Open in IMG/M |
| 3300028784|Ga0307282_10155374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 1084 | Open in IMG/M |
| 3300028784|Ga0307282_10421457 | Not Available | 647 | Open in IMG/M |
| 3300028799|Ga0307284_10091052 | Not Available | 1130 | Open in IMG/M |
| 3300028799|Ga0307284_10259934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 692 | Open in IMG/M |
| 3300028810|Ga0307294_10004970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3195 | Open in IMG/M |
| 3300028811|Ga0307292_10023302 | Not Available | 2195 | Open in IMG/M |
| 3300028819|Ga0307296_10522355 | Not Available | 649 | Open in IMG/M |
| 3300028824|Ga0307310_10003421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6036 | Open in IMG/M |
| 3300028876|Ga0307286_10140530 | Not Available | 861 | Open in IMG/M |
| 3300028880|Ga0307300_10012286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2187 | Open in IMG/M |
| 3300031093|Ga0308197_10224448 | Not Available | 653 | Open in IMG/M |
| 3300031198|Ga0307500_10246789 | Not Available | 550 | Open in IMG/M |
| 3300031938|Ga0308175_100030234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4466 | Open in IMG/M |
| 3300031996|Ga0308176_10411272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1353 | Open in IMG/M |
| 3300033551|Ga0247830_11709736 | Not Available | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 24.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Host-Associated | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026827 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ARcpr5yngRDRAFT_0105052 | 3300000043 | Arabidopsis Rhizosphere | MTSVAVEAKQPRRSALSATWAFVKRHVLTVYSLLFFVYLLLPIAIVVVF |
| JGI10216J12902_1000328662 | 3300000956 | Soil | MSAVAVEARRPRKSALATAWAFVKHHALTVYSLLFFAYLLLPIG |
| JGI10216J12902_1071883192 | 3300000956 | Soil | MSVVAVRTGRPRRSVLAAVWAFVKRYALAVYSLLFFAYLMLPI |
| C688J14111_100678473 | 3300001305 | Soil | VQRSRPRRGVLASTWAFVKRHVLTVYSILFFLYLLL |
| C688J14111_100982881 | 3300001305 | Soil | MSAVAVERHTARPSAVSRVLAFVRRHVLTVYSILFFIYLLLPI |
| Ga0066680_106004552 | 3300005174 | Soil | MSSVAVPALSRRYTLATTLRFVRRHLLTAYSILFFAYLLLP |
| Ga0070670_1007513602 | 3300005331 | Switchgrass Rhizosphere | MSLVAVPAQGRASAAVKVWAFVKHHLLAVYSMLFFLYLLLP |
| Ga0066388_1040472161 | 3300005332 | Tropical Forest Soil | VSAVAVQRSRPKRGVLASVWTFVKRNVLTVYSILFFIYLLLPI |
| Ga0070689_1018788212 | 3300005340 | Switchgrass Rhizosphere | MSAVAVERARTRRSAFATAWAFVKRHVLTVYSILFFVYLLVPIAVVAVFSFNN |
| Ga0070700_1011566522 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAVAVERARTRGSALATAWAFVKRHLLTVYSILFFAYLLLPIAV |
| Ga0070708_1020469792 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LSAVAVQRNRPRRSVLASVWAFVKRNVLTVYSILFFIYLMLPIAVV |
| Ga0070678_1006209892 | 3300005456 | Miscanthus Rhizosphere | LSAVAVQPNRPRRGVLASTWTFVKRHVLTVYSVLFFVYLLLPIAVVV |
| Ga0070681_112501541 | 3300005458 | Corn Rhizosphere | MSAVAVERRERRNPLAGIWAFVKRNVLTVYSILFFVYLLLPIAVVIVF |
| Ga0066697_102750961 | 3300005540 | Soil | MSSIAVPTAREPNVLATVLAFVRRHVLTVYSFLFFAYLLLPIAV |
| Ga0070664_1020229231 | 3300005564 | Corn Rhizosphere | VSAVAVEGGRARGGALSGAWAFVKRHVLTVYSILFFAYLLLPIAVVAVF |
| Ga0066905_1006814242 | 3300005713 | Tropical Forest Soil | MSTVAVPAPRERNVLASVWAFVRRHVLTVYSILFFIYLLL |
| Ga0066903_1005443571 | 3300005764 | Tropical Forest Soil | MSAVAVPARAQRRNVLASVWAFVRRHVLTVYSILFFAYLLLPI |
| Ga0066651_105284872 | 3300006031 | Soil | MSSIAVPRQRERNVLAAAFGFVRYHVLTVYSLLFFA |
| Ga0074059_120902512 | 3300006578 | Soil | MSTVAVPARRERRGVLSAVWAFVKRHVLTVYSILFFAYLLLPIAVVVV |
| Ga0074054_119966121 | 3300006579 | Soil | MTTVVVEAKQPRGSALSATWAFVKRHILTVYSLLFFA |
| Ga0074049_130372362 | 3300006580 | Soil | MTTAVVEAGRPRRSVLARTWAFVKRHILTVYSLLFFAYL |
| Ga0074060_118206461 | 3300006604 | Soil | MSTVAVPARRERRGVLSAVWAFVKRHVLTVYSILFFAYLLLPI |
| Ga0066653_100191981 | 3300006791 | Soil | MSAVAATAQPRARNFAASAWAFVKHHVLTVYSILFFLYLLLP |
| Ga0066658_103512782 | 3300006794 | Soil | MTSVAVSAPRRRSATSVWAFARRNVLTVYSILFFAYLLL |
| Ga0075419_105840631 | 3300006969 | Populus Rhizosphere | MSTVAVERATRTNVLSRVWTFVKHHILTVYSILFFVYLLLPIAVVVVFSFNNP |
| Ga0105251_105242362 | 3300009011 | Switchgrass Rhizosphere | MSAVAVERARTRRSAFATAWAFVKRHVLTVYSILFFVYLLVPIAVVAVFSFNNP |
| Ga0105248_106550173 | 3300009177 | Switchgrass Rhizosphere | MSAVAGERGRTRGSAFATAWAFVKRHVLTVYSILFFVYLL |
| Ga0126380_122327041 | 3300010043 | Tropical Forest Soil | LSAVAVQRSRPGRGVLASTWAFVKRHVLTVYSILFFVYLLLPIAVVVL |
| Ga0127449_10014091 | 3300010117 | Grasslands Soil | MSAVAVERRAGRPSVLARAWAFVRHHLLTVYSILFFAYLLLPIAVVV |
| Ga0134065_104880261 | 3300010326 | Grasslands Soil | LTSVAVQRSRPRRGVLASTWAFVKRHVLTVYSILFFAY |
| Ga0134071_106072213 | 3300010336 | Grasslands Soil | MSSIAVPARREGGNALRSVLAFIRRHVLTVYSLLFFAYLLLPIAV |
| Ga0126376_116686871 | 3300010359 | Tropical Forest Soil | MSAVAVQRGRPKRGVLASTWTFVKRHVLTVYSILFFIYLLLPIAVVNSK* |
| Ga0105239_101168591 | 3300010375 | Corn Rhizosphere | LSAVAVQPNRPRRGVLASTWTFVKRHVLTVYSVLF |
| Ga0137364_101811871 | 3300012198 | Vadose Zone Soil | MSSIAVDQRAGRSPAAAALAFVRRHILTAYSVLFFAYLLLPIAVVVVF |
| Ga0137365_105540441 | 3300012201 | Vadose Zone Soil | MSSIAVSAQREGNVLRTSLAFVRRHVLTVYSLLFFAYLLL |
| Ga0137380_115861581 | 3300012206 | Vadose Zone Soil | MSSIAVEQRAGRGPAAAALAFVRRHILTVYSVLFFAY |
| Ga0137378_100660334 | 3300012210 | Vadose Zone Soil | MSAVAVEGGRERHLATTLWAFVRRHLPTLYSFLFFAYLLLPIA |
| Ga0137378_113500962 | 3300012210 | Vadose Zone Soil | LSAVAVDRSHSRRSTPAAAWAFVKRHVLTLYSALFFAYLM |
| Ga0137377_114556781 | 3300012211 | Vadose Zone Soil | LSAVAVERSWPRRRVLASTWAFVKRHVLTVYSVLFFLYL |
| Ga0150985_1152145163 | 3300012212 | Avena Fatua Rhizosphere | VNAVAVERHTVRPNAVSRALAFVRRHVLTVYSILFFVYLLLPIAVVVVFS |
| Ga0157343_10249581 | 3300012488 | Arabidopsis Rhizosphere | MSAVAATTASPRRNPLAAVWAFVRHHVLTVYSILFF |
| Ga0157350_10443762 | 3300012499 | Unplanted Soil | MSTVAVERATRTNVLSRVWTFVKHHILTVYSILFFVYLLLPIAVVVVF* |
| Ga0157285_102700982 | 3300012897 | Soil | MSAVAVERARTRGSALATAWAFVKRHVLTVYSLLF |
| Ga0157301_102455872 | 3300012911 | Soil | MSAVAVERARTRGSALATAWAFVKRHVLTVYSHLFFAYLLLPIAVI |
| Ga0164301_112087752 | 3300012960 | Soil | MSAVAVERRERRNPLAGIWAFVKRNVLTVYSILFFVYLLLPIAVVIVFSF |
| Ga0164309_114933711 | 3300012984 | Soil | MSSIAVPARSRRNTLATTLGFVRRHLLTAYSILFFAYLLLPIAVVILFS |
| Ga0164304_102226753 | 3300012986 | Soil | MSAVAVEQRRARAGFLTDAWAFVKHHVLTVYSILFFAYLLLPIGVVVLFSFN |
| Ga0157378_127375092 | 3300013297 | Miscanthus Rhizosphere | LSAVAVQPNRPRRGVLASTWTFVKRHALTVYSVLFFVYLLLP |
| Ga0134079_101896292 | 3300014166 | Grasslands Soil | MSSIAVPARREGSNALRTVLSFIRRHVLTVYSLLFFVY |
| Ga0163163_120647052 | 3300014325 | Switchgrass Rhizosphere | MSVVAVRTGRPRRSVLAAVWAFVKRYALAVYSLLFFAYLML |
| Ga0182008_104074561 | 3300014497 | Rhizosphere | MSAVAVPAGSRVGAAAGVWAFVKRHVLTVYSILFFLYLLLPIGV |
| Ga0157377_113175231 | 3300014745 | Miscanthus Rhizosphere | MSAVAATTASPRRNPLAAVWAFVRHHVLTVYSILFFV |
| Ga0157376_117435772 | 3300014969 | Miscanthus Rhizosphere | MSAVAVERSRPKRGVLASTWAFVKRHVLTVYSILFFIYLLLPIAVVVVF |
| Ga0132256_1036955961 | 3300015372 | Arabidopsis Rhizosphere | MTTATEAIQAPAQRVRTSPLAFVRRHVLTVYSLLVFAYLLLPIVIVV |
| Ga0132255_1011827101 | 3300015374 | Arabidopsis Rhizosphere | VSAVAAERSRPRRGALASTWAFVKRNVLAAYSILFFIYLLLPIAVVVAFSF |
| Ga0187785_106081962 | 3300017947 | Tropical Peatland | VSAVAAERPPAGRSFAASTWDLVKRHVLTVYSILFFV |
| Ga0184617_10916821 | 3300018066 | Groundwater Sediment | MSAVAVEAQRERRSFLAAAWAFVKHHILTLYSILFFAYLLIPIAV |
| Ga0066667_100145686 | 3300018433 | Grasslands Soil | MSSIAVPRQRERNVLAAAFGFVRYHVLTVYSLLFFAYLL |
| Ga0066667_107834602 | 3300018433 | Grasslands Soil | MSSAAAAVRSRPSVAAGVWAFARHHVLTVYSILFFLYLLLPIAI |
| Ga0066669_117315621 | 3300018482 | Grasslands Soil | MSSIAVPRQRERNVLAAAFGFVRYHVLTVYSLLFFAYLLLPIAIVVV |
| Ga0193704_10402302 | 3300019867 | Soil | MSSIAVPARSRRNPLATTLGFVRRHLLTAYSILFFAYLLLPIAVVILFS |
| Ga0193722_10427571 | 3300019877 | Soil | MSAVAVATQPRRGLLAAAWAFVRHHLLTLYSFLFFAYLLFPI |
| Ga0193722_11484791 | 3300019877 | Soil | MSSIAVPARSRRNPLATTLGFVRRHLLTAYSILFFAY |
| Ga0193755_10864501 | 3300020004 | Soil | MSTVAVPARRERPGFLAAAWAFVKRHVLTVYSILFFAYLLLPIAVVVVFSF |
| Ga0210381_100878021 | 3300021078 | Groundwater Sediment | MSSIAVDQQAGRRPAAAALAFVRRHILTVYSVLFFAYLLLPIAVV |
| Ga0222623_100077841 | 3300022694 | Groundwater Sediment | MSSIAVPARSRRNPLATTLGFVRRHLLTAYSILFFAYLL |
| Ga0247665_10463811 | 3300024219 | Soil | MSAVAVERARTRGSAPATAWAFVKRHVLTVYSVLFFAYLLLPIAVVA |
| Ga0207654_100356521 | 3300025911 | Corn Rhizosphere | LSAVAVQPNRPRRGVLASTWTFVKRHVLTVYSVLFFVYLLLPIAVV |
| Ga0207654_104936482 | 3300025911 | Corn Rhizosphere | VSAVAVEGGRARGGALSGAWAFVKRHVLTVYSILFFAYLLLPIAVV |
| Ga0207657_114553451 | 3300025919 | Corn Rhizosphere | LSAVAVQRNRPRRSVLASVWAFVKRNVLTVYSILFFIY |
| Ga0207659_103888103 | 3300025926 | Miscanthus Rhizosphere | LSAVAVQRNRPRRSVLASVWAFVKRNVLTVYSILFFIYLMLPIAVVVVFS |
| Ga0207701_114060851 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAVAVERRERRNPLAGIWAFVKRNVLTVYSILFFVY |
| Ga0207704_113830331 | 3300025938 | Miscanthus Rhizosphere | LSAVAVQPNRPRRGVLASTWTFVKRHVLTVYSVLFFVNLLLPIAVVVV |
| Ga0207665_102770863 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAVAVDQRRPRAGFFAAAWAFVKHHVLTVYSILFFGYLLLPIGV |
| Ga0207661_106561782 | 3300025944 | Corn Rhizosphere | MSAVAMPARQKANPVVSLWAFVRRHTLTVYSVLFF |
| Ga0207661_110798781 | 3300025944 | Corn Rhizosphere | MSAVAVERARTRGSAPATAWAFVKRHVLTVYSVLFFAY |
| Ga0207702_114745142 | 3300026078 | Corn Rhizosphere | MSAVAVERARTRGSIFATAWAFVKRHVLTVYSILFFVYLLVPIAVVAV |
| Ga0207641_122144451 | 3300026088 | Switchgrass Rhizosphere | MSAVAATTASPRRNPLAAVWAFVRHHVLTVYSILFFVYLLLPIAVVVLF |
| Ga0209468_10602121 | 3300026306 | Soil | MSAVAATAQPRARNFAASAWAFVKHHVLTVYSILFFLYLL |
| Ga0209472_10720511 | 3300026323 | Soil | MSSIAVPRQRERNVLAAAFGFVRYHVLTVYSLLFFAYLLLPIAIVVVFS |
| Ga0209057_11941341 | 3300026342 | Soil | MSSIAVPTAREPNVLATVLAFVRRHVLTVYSLLFF |
| Ga0207591_1012792 | 3300026827 | Soil | MSTVAVERATRTNVLSKVWTFVKHHILTVYSILFFVYLLLPIAV |
| Ga0307295_101620491 | 3300028708 | Soil | MSSIAVPARSRRNPLATTLGFVRRHLLTAYSILFFAYLLL |
| Ga0307298_100033311 | 3300028717 | Soil | MSAVAVEPRRERTNLLAKVLAFVRHHLLTAYSLLFFAYLLLPIAVVV |
| Ga0307307_100926611 | 3300028718 | Soil | LSSIAAPARRERSVLATVLAFVRRKALAVYSLLFFAYLLLPI |
| Ga0307282_101553741 | 3300028784 | Soil | MSSIAVPRQRERNVLAAALGFVRYHVLTVYSLLFFAYLLLPIAIVVV |
| Ga0307282_104214571 | 3300028784 | Soil | MSSIAAPVRRERSVLATVLAFVRRHALAAYSLLFFAYLLLPI |
| Ga0307284_100910521 | 3300028799 | Soil | MSSIAVPVRRQGNALAKTFAFVRRHVLTVYSLLFF |
| Ga0307284_102599341 | 3300028799 | Soil | LSSIAAPARRERSVLATVLAFVRRHALAAYSLLFFAYLLLPIAIVIAFS |
| Ga0307294_100049704 | 3300028810 | Soil | MSAVAVERARPNVFSKVWAFVRHHILTAYSILFFVYLLLPIAVVVV |
| Ga0307292_100233022 | 3300028811 | Soil | MSSIAVTRARERNVLGATLGFVRHHILTVYSLLFFAYLLLPIAIVVAF |
| Ga0307296_105223552 | 3300028819 | Soil | LSSIAAPARRERSVLATVLAFVRRKALAVYSLLFFAYLLLPIAIV |
| Ga0307310_100034218 | 3300028824 | Soil | MSAVAVESRPRRHVLAGAWAFVRRHILTVYSVLFF |
| Ga0307286_101405301 | 3300028876 | Soil | MSTVAVPARRERRGFLSAVWAFVKRHVLTVYSILFFAYLLLPIAVVV |
| Ga0307300_100122861 | 3300028880 | Soil | MSAVAVSAPRRSRGLARVWAFVRRHVLTVSAMLGFAYLL |
| Ga0308197_102244481 | 3300031093 | Soil | MSSIAVTRERERNVLGAALGFVRHHILSVYSLLFFA |
| Ga0307500_102467891 | 3300031198 | Soil | VSSATAVSARPRRSALANVWAFVRRHVLTAYSILFFIY |
| Ga0308175_1000302341 | 3300031938 | Soil | MSAIAVERARTRGSALATTWAFVKRHVLTVYSILFFAYLL |
| Ga0308176_104112721 | 3300031996 | Soil | VTTVAIERRPGRPSVLAKTWSFVRRHVLTAYSILFFVYLLLPIA |
| Ga0247830_117097362 | 3300033551 | Soil | MSTVAVPAGRERPGFLAAAWAFVKRHVLTVYSILFFAYLL |
| ⦗Top⦘ |