| Basic Information | |
|---|---|
| Family ID | F105117 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MLDKAQRRDAGAKLVALARAATQAVEALLADATAAVRRRVMVD |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.00 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF03631 | Virul_fac_BrkB | 34.00 |
| PF01979 | Amidohydro_1 | 22.00 |
| PF00892 | EamA | 5.00 |
| PF00672 | HAMP | 2.00 |
| PF08240 | ADH_N | 2.00 |
| PF03401 | TctC | 1.00 |
| PF00398 | RrnaAD | 1.00 |
| PF01642 | MM_CoA_mutase | 1.00 |
| PF00221 | Lyase_aromatic | 1.00 |
| PF02310 | B12-binding | 1.00 |
| PF13147 | Obsolete Pfam Family | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 34.00 |
| COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 1.00 |
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 1.00 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.00 % |
| Unclassified | root | N/A | 40.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000580|AF_2010_repII_A01DRAFT_1003084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2688 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10088616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 770 | Open in IMG/M |
| 3300000955|JGI1027J12803_100782195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 559 | Open in IMG/M |
| 3300000956|JGI10216J12902_100045383 | Not Available | 1274 | Open in IMG/M |
| 3300001661|JGI12053J15887_10116109 | Not Available | 1436 | Open in IMG/M |
| 3300002155|JGI24033J26618_1045734 | Not Available | 619 | Open in IMG/M |
| 3300002459|JGI24751J29686_10093294 | Not Available | 627 | Open in IMG/M |
| 3300003911|JGI25405J52794_10018905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1378 | Open in IMG/M |
| 3300003911|JGI25405J52794_10035183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1048 | Open in IMG/M |
| 3300003911|JGI25405J52794_10049195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 902 | Open in IMG/M |
| 3300004081|Ga0063454_100900258 | Not Available | 699 | Open in IMG/M |
| 3300005160|Ga0066820_1002095 | Not Available | 947 | Open in IMG/M |
| 3300005328|Ga0070676_10714757 | Not Available | 733 | Open in IMG/M |
| 3300005367|Ga0070667_100011267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7395 | Open in IMG/M |
| 3300005548|Ga0070665_100461970 | Not Available | 1280 | Open in IMG/M |
| 3300005764|Ga0066903_108977770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 506 | Open in IMG/M |
| 3300005985|Ga0081539_10076377 | Not Available | 1775 | Open in IMG/M |
| 3300006579|Ga0074054_12083430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
| 3300006800|Ga0066660_10258497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1366 | Open in IMG/M |
| 3300006854|Ga0075425_100667012 | Not Available | 1195 | Open in IMG/M |
| 3300009036|Ga0105244_10418962 | Not Available | 616 | Open in IMG/M |
| 3300009147|Ga0114129_11463252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 841 | Open in IMG/M |
| 3300009148|Ga0105243_12730504 | Not Available | 534 | Open in IMG/M |
| 3300009177|Ga0105248_12054408 | Not Available | 649 | Open in IMG/M |
| 3300009545|Ga0105237_10343084 | Not Available | 1498 | Open in IMG/M |
| 3300009840|Ga0126313_11721686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 523 | Open in IMG/M |
| 3300010043|Ga0126380_10668397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 830 | Open in IMG/M |
| 3300010046|Ga0126384_11427794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 646 | Open in IMG/M |
| 3300010047|Ga0126382_10778700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 813 | Open in IMG/M |
| 3300010366|Ga0126379_13779849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 507 | Open in IMG/M |
| 3300010868|Ga0124844_1282911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 569 | Open in IMG/M |
| 3300012357|Ga0137384_10854250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 734 | Open in IMG/M |
| 3300012357|Ga0137384_11069721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 647 | Open in IMG/M |
| 3300012362|Ga0137361_11426485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 615 | Open in IMG/M |
| 3300012913|Ga0157298_10055055 | Not Available | 932 | Open in IMG/M |
| 3300012939|Ga0162650_100065356 | Not Available | 614 | Open in IMG/M |
| 3300012984|Ga0164309_10593768 | Not Available | 863 | Open in IMG/M |
| 3300012985|Ga0164308_10742088 | Not Available | 850 | Open in IMG/M |
| 3300014969|Ga0157376_10110290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 2420 | Open in IMG/M |
| 3300015371|Ga0132258_13361182 | Not Available | 1100 | Open in IMG/M |
| 3300015372|Ga0132256_100317733 | Not Available | 1645 | Open in IMG/M |
| 3300016319|Ga0182033_10467065 | Not Available | 1079 | Open in IMG/M |
| 3300016445|Ga0182038_11238091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 666 | Open in IMG/M |
| 3300017965|Ga0190266_10569599 | Not Available | 678 | Open in IMG/M |
| 3300018052|Ga0184638_1151159 | Not Available | 838 | Open in IMG/M |
| 3300018482|Ga0066669_11492528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 614 | Open in IMG/M |
| 3300019361|Ga0173482_10214482 | Not Available | 797 | Open in IMG/M |
| 3300019789|Ga0137408_1166671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 748 | Open in IMG/M |
| 3300019869|Ga0193705_1071666 | Not Available | 683 | Open in IMG/M |
| 3300020002|Ga0193730_1001673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6014 | Open in IMG/M |
| 3300021080|Ga0210382_10143957 | Not Available | 1018 | Open in IMG/M |
| 3300022901|Ga0247788_1110544 | Not Available | 548 | Open in IMG/M |
| 3300025924|Ga0207694_10617060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 912 | Open in IMG/M |
| 3300026359|Ga0257163_1041369 | Not Available | 731 | Open in IMG/M |
| 3300027050|Ga0209325_1011578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 994 | Open in IMG/M |
| 3300027313|Ga0207780_1046691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 745 | Open in IMG/M |
| 3300027546|Ga0208984_1004428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 2481 | Open in IMG/M |
| 3300027643|Ga0209076_1069022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1004 | Open in IMG/M |
| 3300027646|Ga0209466_1000965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 5771 | Open in IMG/M |
| 3300027646|Ga0209466_1001994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4155 | Open in IMG/M |
| 3300027903|Ga0209488_10554954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 837 | Open in IMG/M |
| 3300028047|Ga0209526_10488849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 804 | Open in IMG/M |
| 3300028381|Ga0268264_12388442 | Not Available | 535 | Open in IMG/M |
| 3300028793|Ga0307299_10053997 | Not Available | 1480 | Open in IMG/M |
| 3300028799|Ga0307284_10303700 | Not Available | 641 | Open in IMG/M |
| 3300031199|Ga0307495_10217550 | Not Available | 533 | Open in IMG/M |
| 3300031226|Ga0307497_10186514 | Not Available | 888 | Open in IMG/M |
| 3300031455|Ga0307505_10211223 | Not Available | 897 | Open in IMG/M |
| 3300031543|Ga0318516_10435461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 754 | Open in IMG/M |
| 3300031561|Ga0318528_10110446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1448 | Open in IMG/M |
| 3300031668|Ga0318542_10230555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 939 | Open in IMG/M |
| 3300031679|Ga0318561_10005973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4988 | Open in IMG/M |
| 3300031681|Ga0318572_10302451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 945 | Open in IMG/M |
| 3300031681|Ga0318572_10763722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 575 | Open in IMG/M |
| 3300031719|Ga0306917_10165083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1654 | Open in IMG/M |
| 3300031719|Ga0306917_11118776 | Not Available | 613 | Open in IMG/M |
| 3300031723|Ga0318493_10509574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 665 | Open in IMG/M |
| 3300031724|Ga0318500_10019740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2558 | Open in IMG/M |
| 3300031740|Ga0307468_102196732 | Not Available | 534 | Open in IMG/M |
| 3300031771|Ga0318546_10071309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2219 | Open in IMG/M |
| 3300031778|Ga0318498_10492214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 540 | Open in IMG/M |
| 3300031779|Ga0318566_10414383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 662 | Open in IMG/M |
| 3300031780|Ga0318508_1102990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 793 | Open in IMG/M |
| 3300031781|Ga0318547_10764480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 601 | Open in IMG/M |
| 3300031792|Ga0318529_10090252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1373 | Open in IMG/M |
| 3300031832|Ga0318499_10424807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 507 | Open in IMG/M |
| 3300031846|Ga0318512_10024131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2545 | Open in IMG/M |
| 3300031860|Ga0318495_10057048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1733 | Open in IMG/M |
| 3300031893|Ga0318536_10162559 | Not Available | 1136 | Open in IMG/M |
| 3300031910|Ga0306923_10991238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 913 | Open in IMG/M |
| 3300031941|Ga0310912_11125013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 599 | Open in IMG/M |
| 3300031945|Ga0310913_10157447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1572 | Open in IMG/M |
| 3300031945|Ga0310913_10441035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 924 | Open in IMG/M |
| 3300031947|Ga0310909_10346559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1246 | Open in IMG/M |
| 3300032044|Ga0318558_10607667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 546 | Open in IMG/M |
| 3300032061|Ga0315540_10030219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2670 | Open in IMG/M |
| 3300032068|Ga0318553_10549045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 605 | Open in IMG/M |
| 3300032163|Ga0315281_12093902 | Not Available | 538 | Open in IMG/M |
| 3300032174|Ga0307470_10387009 | Not Available | 984 | Open in IMG/M |
| 3300034819|Ga0373958_0039514 | Not Available | 960 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.00% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A01DRAFT_10030844 | 3300000580 | Forest Soil | MLDKAQRRDAGAKLIALARAATQAVEALLADATAAVRR |
| AF_2010_repII_A1DRAFT_100886161 | 3300000597 | Forest Soil | MLDQAQRRDAGAKLIALARAATQAVEALLVDATAAVRRRVMVDDQVVDRLLDR |
| JGI1027J12803_1007821952 | 3300000955 | Soil | MLDKAQDRDAGAQLVARAREATQAAEAVLADATLAVRQRVTVDNRMDD |
| JGI10216J12902_1000453831 | 3300000956 | Soil | MLDQAQRPDAAPKLVALAGEATQAADALLAEATAAVRRRVMVGERMVDELL |
| JGI12053J15887_101161091 | 3300001661 | Forest Soil | MLDDAQRRDAGVKLLALAREATRAAEALLAEATAAVRGRVTVEGHMVEAL |
| JGI24033J26618_10457341 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDQAQRSDAAPKLVALAREATQAADALLAEATAA |
| JGI24751J29686_100932942 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | MLDQAQRCGAAPRLVALAREATQAADALLAEATAAVRQRV |
| JGI25405J52794_100189051 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MLDXSEGRDDGAKLVALAREATLAAEALLGDATRAVRQRVTIDNQMVDRLLD |
| JGI25405J52794_100351832 | 3300003911 | Tabebuia Heterophylla Rhizosphere | VLDKAQRRDAGVKLIALARQARDAVEALLGDATAAVRGRVSVDH |
| JGI25405J52794_100491951 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MLDKAQGRDDGAKLIAIAREATLAVEALLADATEAVRQRVTIDNQMDDRL |
| Ga0063454_1009002581 | 3300004081 | Soil | MLDQAQRSDAAPKLVALAREATQAADALLAEATAAVRRRVM |
| Ga0066820_10020952 | 3300005160 | Soil | MLDQAQRSDAAPKLVALAREATQAADALLAEATAAVRRRVMVDERMVDGLL |
| Ga0070676_107147572 | 3300005328 | Miscanthus Rhizosphere | MLDQAQRPDAAPKLVALAREATQAADALLAEATAAVRRRVMVDE |
| Ga0070667_1000112671 | 3300005367 | Switchgrass Rhizosphere | MLDQAQRSDAAPKLVALAREATQAADALLAEATAAVRRRVMVDE |
| Ga0070665_1004619701 | 3300005548 | Switchgrass Rhizosphere | MLDQAQRPDAAPKLVALAGEATQAADALLAEATAAVRRR |
| Ga0066903_1089777702 | 3300005764 | Tropical Forest Soil | MLDHAQRRDAGAKLIALARAATQAVEALLADATAAVRRRVMVDDQVVD |
| Ga0081539_100763772 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MLDKGERRDAGVKLLAVTREATRTAEAVLADARA* |
| Ga0074054_120834302 | 3300006579 | Soil | MLDQAQRPDAAPKLVALAQDATQAVDTLLAEATAAV |
| Ga0066660_102584971 | 3300006800 | Soil | VLDKAQRRDAGVKLIALARQATEAVEALLADATAAVRGRVTVDHQMLDALL |
| Ga0075425_1006670122 | 3300006854 | Populus Rhizosphere | MLDQAQRSGAAPRLVALAREATQAADALLAEATAAVRQRVTVDG |
| Ga0105244_104189621 | 3300009036 | Miscanthus Rhizosphere | MLDQAQRPDAAPKLVALAREATQAADALLAEATAAVRRRVMIDERMV |
| Ga0114129_114632521 | 3300009147 | Populus Rhizosphere | MLDKSQARDDGAKLVALAREATLAAETLLADATRAVRQRVTIDNQMVDRLLD |
| Ga0105243_127305041 | 3300009148 | Miscanthus Rhizosphere | MLDQAQRPDAAPKLVALAREATQAADALLAEATAAVRRRV |
| Ga0105248_120544081 | 3300009177 | Switchgrass Rhizosphere | MLDQAQRPDAAPKLVALARQATQAADALLAEATAAVRRRVTVDERMVD |
| Ga0105237_103430841 | 3300009545 | Corn Rhizosphere | MLDQAQRSDAAPKLVALAREATQAADALLAEATAAV |
| Ga0126313_117216862 | 3300009840 | Serpentine Soil | VLARETVVLDKAQRRDAGAKLIALARQAREAVEALLGDATAAVRGRVTVDHQVLDAL |
| Ga0126380_106683972 | 3300010043 | Tropical Forest Soil | MVVLDKAQRRDAGAKLIALARQARDAVEALLADATA |
| Ga0126384_114277941 | 3300010046 | Tropical Forest Soil | MLDQAQRRDAGAKLIALARAATQAVEALLADATAAVRRR |
| Ga0126382_107787001 | 3300010047 | Tropical Forest Soil | LASSRRIVVLDKAQRRDAEVELITQARRANDAVEALLANAT |
| Ga0126379_137798492 | 3300010366 | Tropical Forest Soil | MLDKAQRRDAGAKLIALARAATQAVEALLADATAAVRRRVLVDDQVVDQLLDR |
| Ga0124844_12829111 | 3300010868 | Tropical Forest Soil | MLDQAQRRDAGAKLIALAHAATQAVEALLADATVTVS |
| Ga0137384_108542502 | 3300012357 | Vadose Zone Soil | MLDQAEPRAAGADLVASSRAAVGAAEMLLGQATAAVRRRVTVDDQVVDRLFDRE |
| Ga0137384_110697211 | 3300012357 | Vadose Zone Soil | MLDQAQRRDAGAKLIALARAATQAVGALLADATVAVRER |
| Ga0137361_114264851 | 3300012362 | Vadose Zone Soil | MLDQAQRRDAGAKLVALARAATQAVEALLADATAAVRRRVMVDDQVVDRL |
| Ga0157298_100550551 | 3300012913 | Soil | MLDQAQRPDAAPQLVALAREATQAADALLAEATAAVRRRVM |
| Ga0162650_1000653562 | 3300012939 | Soil | MLDQAQRPDAAPKLVALAREATQAADALLAEATAAVRRRVTVGERIDDGLLDRE |
| Ga0164309_105937681 | 3300012984 | Soil | MLDQAQRPDAAPKLVALAREASQAADALLAEATVAVRRR |
| Ga0164308_107420881 | 3300012985 | Soil | MLDQAQRSDAAPRLVALAREATQAADALLAEATAVVRQR |
| Ga0157376_101102901 | 3300014969 | Miscanthus Rhizosphere | MLDQAQRSDAAPKLVALAREATQAADALLAEATAAVRRRV |
| Ga0132258_133611822 | 3300015371 | Arabidopsis Rhizosphere | MLDQAQRPDAAPKLVALAQDATQAVDTLLAEATAAVRKRV |
| Ga0132256_1003177331 | 3300015372 | Arabidopsis Rhizosphere | MLDQAQRSDAAPKLVALAREATQAADALLAEATAAVRRRVMVDERM |
| Ga0182033_104670651 | 3300016319 | Soil | MLDKAERRDAGVKLIALAREASRAAEALLAEATAAVRQRVMVEDKVVDRLFDR |
| Ga0182038_112380911 | 3300016445 | Soil | MLDKAQRRDAGAKLIALARAATQAVEALLADATAAVRRRVMVDDQVVD |
| Ga0190266_105695992 | 3300017965 | Soil | MLDQAQRPDAAPKLVALAGEATQAADALLAEATAAVRR |
| Ga0184638_11511591 | 3300018052 | Groundwater Sediment | MLDKAQRHDAGVKLVALAREATRVAEALLAEATTAVRQRVTV |
| Ga0066669_114925282 | 3300018482 | Grasslands Soil | MLDQAQRRDAGAKLVALARAATQAVETLLADATAAVRRRGLGADQGVGRRLDRGQPATHGLHSVA |
| Ga0173482_102144821 | 3300019361 | Soil | MLDQAQRPDAAPKLVALAREATQAADALLAEATAAVRRRVMIDERMVDG |
| Ga0137408_11666712 | 3300019789 | Vadose Zone Soil | MLDQTQRRDAGAKLIALARAATQAVEAVLADATVAVRQR |
| Ga0193705_10716662 | 3300019869 | Soil | MLDQAQRPDAAPKLVALAREATQAVDALLAEATAAVRKRVTVD |
| Ga0193730_10016737 | 3300020002 | Soil | MLDQAQRPDAAPKLVALAREATHAVDALLADATAAV |
| Ga0210382_101439572 | 3300021080 | Groundwater Sediment | MLDQAQRPDAAPKLVALAREATHAVDALLVDATAAV |
| Ga0247788_11105441 | 3300022901 | Soil | MLDQAQRSDAALRLVALARESTQAADALLAEATAA |
| Ga0207694_106170601 | 3300025924 | Corn Rhizosphere | MLDQAQRPDAAPKLVALAREATQAADALLAEATAAVRRRVMIDERMVDGLLDR |
| Ga0257163_10413692 | 3300026359 | Soil | MLDQAQRPDAAPKLVALAQEATQAVDALLAEATAAVRKRVTVDNRMVDGLFD |
| Ga0209325_10115782 | 3300027050 | Forest Soil | MLDKAQRRDAGAKLIALARAATQAVEALLVDATAAVRRRVMLDDQVVDRLLDR |
| Ga0207780_10466911 | 3300027313 | Tropical Forest Soil | MSNAQRRDAGVTLLALAREATRACETLLAEATAAVRSRVTVEDRLVERS |
| Ga0208984_10044281 | 3300027546 | Forest Soil | MLDQAQRPDAAPKLVALAREATQAVDALLAEATAAVRQRVTVDNRIVDALLD |
| Ga0209076_10690222 | 3300027643 | Vadose Zone Soil | VVLDKAERPDAELIALARQAAQAAETLLDDATAAVRRRVTVDHRLDERLL |
| Ga0209466_10009658 | 3300027646 | Tropical Forest Soil | MLDKAQRHDAGVKLIALAREATRAAETLLAEATAAVRQRVTVEGRVVDRMFDREQ |
| Ga0209466_10019941 | 3300027646 | Tropical Forest Soil | MLDQAQRRDAGAKLTALARTATQAVEALVADATAAVRQ |
| Ga0209488_105549542 | 3300027903 | Vadose Zone Soil | MLDKAERRDAGVKLLAVAREATRTAEALLAEATAAVRRRVTVEDKLVDGL |
| Ga0209526_104888491 | 3300028047 | Forest Soil | LDKAQRRDAGVKLIALAREATCAAEQLLAEATAAV |
| Ga0268264_123884422 | 3300028381 | Switchgrass Rhizosphere | MLDQAQRPDAAPKLVALARQATQAADALLAEATAAVRRRVTVDER |
| Ga0307299_100539972 | 3300028793 | Soil | MLDQAQRPDAAPKLVALAREATHAVDALLADATAAVRK |
| Ga0307284_103037002 | 3300028799 | Soil | MLDQAQRPDAAPKLVALAREATQAADALLAEATAAVRRRVMVDERMVD |
| Ga0307495_102175501 | 3300031199 | Soil | MLDKAQRRDAGVRLTAQAREATRAAEALLAEATAAVRKRVTADGHMV |
| Ga0307497_101865141 | 3300031226 | Soil | MLDQAQRSDAAPKLVALAREATQAADALLAEATAAVRRRVMVDERMV |
| Ga0307505_102112232 | 3300031455 | Soil | MLDQAQRPDAAPKLVALAREATQAADALLAEATAAVRRRVMVDERMVDGLL |
| Ga0318516_104354612 | 3300031543 | Soil | MLDKAQRRDAGAKLVALARAATQAVEALLADATAAVRRRVMVDDQ |
| Ga0318528_101104462 | 3300031561 | Soil | VLDKAQRRDAEVELITQARRASEAVEALLANATAAVRQRVT |
| Ga0318542_102305551 | 3300031668 | Soil | VLDKAQRRDAEVELITQARRASEAVEALLANATAAVRQRVTMDDE |
| Ga0318561_100059731 | 3300031679 | Soil | MSDAQRRDAGVPLLALAREATRACETLLAEATAAV |
| Ga0318572_103024511 | 3300031681 | Soil | MLDKAQRRDAGAKLVALARAATQAVEALLADATAAVRRRVMVDDQVVDRLLDRE |
| Ga0318572_107637221 | 3300031681 | Soil | VLDKAQRRDAEVELITQARRASEAVEALLANATAAVRQ |
| Ga0306917_101650833 | 3300031719 | Soil | VLDKAQRRDAEVELITQARRASEAVEALLANATAAVRQRVTVDDEMVDALLD |
| Ga0306917_111187761 | 3300031719 | Soil | MLDKAERRDAGVKLIALAREATRAGEALLAEATAAVRQRV |
| Ga0318493_105095742 | 3300031723 | Soil | MLDKAQRRDAGAKLIALARAATQAVEALLADATAAVRQRVMVDDQ |
| Ga0318500_100197401 | 3300031724 | Soil | MSDAQRRDAGVTLLALAREATRGCETLLAEATVAVRSRVTVEDRLVEHSLDRE |
| Ga0307468_1021967321 | 3300031740 | Hardwood Forest Soil | MLDKAQRHDAGVKLVALAREATRVVETLLAEGIAAVRQRVTVEGRVVDRM |
| Ga0318546_100713094 | 3300031771 | Soil | VLDKAQRRDAEVELITQARRASEAVEALLATATAAVRQRVTMDDE |
| Ga0318498_104922142 | 3300031778 | Soil | MLDKAQRRDAGAKLVALARAATQAVEALLADATAAVRRRVMVD |
| Ga0318566_104143831 | 3300031779 | Soil | MLDKAQRRDAGAKLIALARAATQAVEALLADATAAVRRRVMVD |
| Ga0318508_11029901 | 3300031780 | Soil | MSDAQRRDAGVPLLALAREATRACETLLAEATAAVRS |
| Ga0318547_107644801 | 3300031781 | Soil | MLDKAQRRGAGAKLIALARAATQAVEALLADATAAVRRRVMVDDQVVDQLLD |
| Ga0318529_100902523 | 3300031792 | Soil | MSDAQRRDAGVPLLALAREATRACETLLAEATVAVRSR |
| Ga0318499_104248071 | 3300031832 | Soil | MLDQAQRRDAGAKLIALARAATQAVEALLADATAAVGRRVMVDD |
| Ga0318512_100241311 | 3300031846 | Soil | MSDAQRRDAGVPLLALAREATRACETLLAEATAAVRSRVTVE |
| Ga0318495_100570481 | 3300031860 | Soil | MLDQAQRRDAGAKLIALAHAATQAVEALLADATVAVRQRVTIDHQVVDRL |
| Ga0318536_101625592 | 3300031893 | Soil | MLDKAERRDAGVKLIALAREATRAAEALLAEATAAVRQRVMVEDKVVERLFD |
| Ga0306923_109912382 | 3300031910 | Soil | MLDKAQRRDAGAKLIALARAATQAVEALLADATAAVR |
| Ga0310912_111250131 | 3300031941 | Soil | MLDKAQRRDAGAKLVALARAATQAVEALLADATAAVRRRVMVDDQVVDRLL |
| Ga0310913_101574473 | 3300031945 | Soil | MLDQAQRRDAGAKLIALAHAATQAVEALLADATVAVRQRVTIDHQVVDRLF |
| Ga0310913_104410352 | 3300031945 | Soil | MLDQAQRRDAGAKLIALARAATQAVEALLADATAAVRRRVMVDDQVVD |
| Ga0310909_103465591 | 3300031947 | Soil | MLDQAQRRDAGAKLIALARAATQAVEALLADATAAVRRRVMVDDQVVDRL |
| Ga0318558_106076672 | 3300032044 | Soil | MLDQAQRRDAGAKLIALARAATQAVEALLADATAAVRRRVMV |
| Ga0315540_100302191 | 3300032061 | Salt Marsh Sediment | MPIVASRPAAGHELVDLGREATAAVDALLADAAAR |
| Ga0318553_105490452 | 3300032068 | Soil | MLDQAQRRDAGAKLIALARAATQAVEALLADATAAVRRRVMVDDQVVDQLL |
| Ga0315281_120939021 | 3300032163 | Sediment | MSMLDKAGRRGAGDRLIAVAREAARAAEALLADATAAVRRRI |
| Ga0307470_103870091 | 3300032174 | Hardwood Forest Soil | MLDQAQRPDAAPKLVALAREATQEADALLAEATAAVRRRV |
| Ga0373958_0039514_2_124 | 3300034819 | Rhizosphere Soil | MLDQAQRPDAAPKLVAFAREATQAADALLAEATAAVRRRVT |
| ⦗Top⦘ |