NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105111

Metagenome / Metatranscriptome Family F105111

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105111
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 52 residues
Representative Sequence ASKIAIHDGRIVKGAQERNGGRKKYFFMGPGEKYDLTKLERIGKPKPTEP
Number of Associated Samples 83
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.00 %
% of genes near scaffold ends (potentially truncated) 99.00 %
% of genes from short scaffolds (< 2000 bps) 94.00 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(12.000 % of family members)
Environment Ontology (ENVO) Unclassified
(46.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(64.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 17.95%    Coil/Unstructured: 82.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF01546Peptidase_M20 30.00
PF00326Peptidase_S9 9.00
PF02687FtsX 4.00
PF04307YdjM 2.00
PF07394DUF1501 2.00
PF07944Glyco_hydro_127 1.00
PF03193RsgA_GTPase 1.00
PF00930DPPIV_N 1.00
PF02494HYR 1.00
PF02626CT_A_B 1.00
PF05163DinB 1.00
PF03575Peptidase_S51 1.00
PF07676PD40 1.00
PF07687M20_dimer 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG1988Membrane-bound metal-dependent hydrolase YbcI, DUF457 familyGeneral function prediction only [R] 2.00
COG0823Periplasmic component TolB of the Tol biopolymer transport systemIntracellular trafficking, secretion, and vesicular transport [U] 1.00
COG1162Ribosome biogenesis GTPase RsgATranslation, ribosomal structure and biogenesis [J] 1.00
COG1506Dipeptidyl aminopeptidase/acylaminoacyl peptidaseAmino acid transport and metabolism [E] 1.00
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 1.00
COG3533Beta-L-arabinofuranosidase, GH127 familyCarbohydrate transport and metabolism [G] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.00 %
UnclassifiedrootN/A1.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004479|Ga0062595_100902174All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium745Open in IMG/M
3300005093|Ga0062594_102745683All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300005364|Ga0070673_101846437All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005436|Ga0070713_101282778All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales710Open in IMG/M
3300005436|Ga0070713_101433424All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300005439|Ga0070711_100786342All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales806Open in IMG/M
3300005446|Ga0066686_10964866All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300005471|Ga0070698_102074773All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300005545|Ga0070695_100878051All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300005552|Ga0066701_10182431Not Available1280Open in IMG/M
3300005553|Ga0066695_10376414All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium885Open in IMG/M
3300005617|Ga0068859_101095631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium876Open in IMG/M
3300005618|Ga0068864_100251622All Organisms → cellular organisms → Bacteria1641Open in IMG/M
3300005618|Ga0068864_102423862All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300005718|Ga0068866_10069428All Organisms → cellular organisms → Bacteria1856Open in IMG/M
3300005764|Ga0066903_101470314All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300005764|Ga0066903_102951722All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300005764|Ga0066903_106937676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300005841|Ga0068863_101187182All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium769Open in IMG/M
3300005843|Ga0068860_100785793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium965Open in IMG/M
3300005843|Ga0068860_101906075All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300005843|Ga0068860_102117001All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300005843|Ga0068860_102787859All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300006031|Ga0066651_10447910All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium685Open in IMG/M
3300006604|Ga0074060_11049022All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium667Open in IMG/M
3300006854|Ga0075425_100457706All Organisms → cellular organisms → Bacteria1469Open in IMG/M
3300006854|Ga0075425_100573386All Organisms → cellular organisms → Bacteria1298Open in IMG/M
3300006871|Ga0075434_101125453All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium798Open in IMG/M
3300006881|Ga0068865_100773909All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium826Open in IMG/M
3300006903|Ga0075426_10043302All Organisms → cellular organisms → Bacteria3216Open in IMG/M
3300006904|Ga0075424_101199926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium808Open in IMG/M
3300006914|Ga0075436_100812155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21697Open in IMG/M
3300009038|Ga0099829_10374458All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1175Open in IMG/M
3300009089|Ga0099828_10421250All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1204Open in IMG/M
3300009089|Ga0099828_10554988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1035Open in IMG/M
3300009090|Ga0099827_11403729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium608Open in IMG/M
3300009090|Ga0099827_11854003All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300009093|Ga0105240_10800471All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp.1021Open in IMG/M
3300009094|Ga0111539_12092259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300009147|Ga0114129_10702738All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1299Open in IMG/M
3300009148|Ga0105243_10589972All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1068Open in IMG/M
3300009162|Ga0075423_10302676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1676Open in IMG/M
3300009162|Ga0075423_12072432All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300009176|Ga0105242_11536884All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300009176|Ga0105242_12971633All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300009177|Ga0105248_10533461All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1324Open in IMG/M
3300009177|Ga0105248_10968405All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300010046|Ga0126384_12366364All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300010301|Ga0134070_10093776All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1042Open in IMG/M
3300010337|Ga0134062_10074609All Organisms → cellular organisms → Bacteria1421Open in IMG/M
3300010399|Ga0134127_12813363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300010400|Ga0134122_10123540All Organisms → cellular organisms → Bacteria2077Open in IMG/M
3300010400|Ga0134122_11625207All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium671Open in IMG/M
3300010401|Ga0134121_12019348All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300012189|Ga0137388_10887862All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium825Open in IMG/M
3300012350|Ga0137372_10059205All Organisms → cellular organisms → Bacteria3343Open in IMG/M
3300012922|Ga0137394_10878631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium749Open in IMG/M
3300012930|Ga0137407_11922159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300012930|Ga0137407_12389927All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300012944|Ga0137410_11635498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300013296|Ga0157374_12057123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_9598Open in IMG/M
3300013297|Ga0157378_10179151All Organisms → cellular organisms → Bacteria1993Open in IMG/M
3300015356|Ga0134073_10101636All Organisms → cellular organisms → Bacteria → Acidobacteria851Open in IMG/M
3300015371|Ga0132258_12190348All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300015371|Ga0132258_12371456All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300015372|Ga0132256_100761902All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1084Open in IMG/M
3300016357|Ga0182032_11442711All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300016387|Ga0182040_10384508All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300017656|Ga0134112_10518115All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300021860|Ga0213851_1224496All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300025899|Ga0207642_11144528All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300025916|Ga0207663_10854318All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300025918|Ga0207662_10086156All Organisms → cellular organisms → Bacteria1925Open in IMG/M
3300025920|Ga0207649_10983025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300025923|Ga0207681_11410585All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300025934|Ga0207686_11487902All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300025935|Ga0207709_11684312All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300025940|Ga0207691_10067950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jatrophihabitantales → Jatrophihabitantaceae → Jatrophihabitans3221Open in IMG/M
3300025941|Ga0207711_10122011All Organisms → cellular organisms → Bacteria2327Open in IMG/M
3300025942|Ga0207689_11326810All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300026035|Ga0207703_10690576All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium970Open in IMG/M
3300026089|Ga0207648_11140866All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300026089|Ga0207648_12244814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300026095|Ga0207676_11527727All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300026116|Ga0207674_10681638All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium992Open in IMG/M
3300026305|Ga0209688_1056264All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300026315|Ga0209686_1031340All Organisms → cellular organisms → Bacteria2041Open in IMG/M
3300027643|Ga0209076_1208044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300027775|Ga0209177_10325413All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300027986|Ga0209168_10137047All Organisms → cellular organisms → Bacteria1246Open in IMG/M
3300028709|Ga0307279_10065402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_9622Open in IMG/M
3300028792|Ga0307504_10350625All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300031545|Ga0318541_10383025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium786Open in IMG/M
3300031548|Ga0307408_100726087All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium895Open in IMG/M
3300031820|Ga0307473_11412128All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031858|Ga0310892_10954433All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300031890|Ga0306925_10600619All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300032122|Ga0310895_10770711All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300032163|Ga0315281_11329432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium711Open in IMG/M
3300034115|Ga0364945_0035058All Organisms → cellular organisms → Bacteria1365Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere10.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.00%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.00%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028709Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062595_10090217413300004479SoilRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPARSEP*
Ga0062594_10274568313300005093SoilRGQQFEITGASKVAIHDGRVVAGERQQRNGKKYFFMAPGERYDLTKLQRIGRQAASEP*
Ga0070673_10184643713300005364Switchgrass RhizosphereTAIVVQGQQFEVIGASKVAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPKPSEP*
Ga0070713_10128277823300005436Corn, Switchgrass And Miscanthus RhizosphereIVVHGQQFEVIGASKVAIHDGVSDPKSEARNGKKYFFMAPGEKYDLTKLERISPPKPSDGQ*
Ga0070713_10143342413300005436Corn, Switchgrass And Miscanthus RhizosphereGASKIAIHDGRMVPGERQQRNGKKYYFMAAGERYDLTKLERIGKRPSVEP*
Ga0070711_10078634223300005439Corn, Switchgrass And Miscanthus RhizosphereVIGASKVAIHDGVSDPKSEARNGKKYFFMAPGEKYDLTKLERISPPKPSDGQ*
Ga0066686_1096486613300005446SoilVVGASKVAIHDGRVVPGERQQRNGKKYYFMAPGERYDLTKLERIGKRPATEQ*
Ga0070698_10207477313300005471Corn, Switchgrass And Miscanthus RhizosphereIVKGAQERHGKKYFFMAPGERYDLTKLERIGRPNRSEQP*
Ga0070695_10087805113300005545Corn, Switchgrass And Miscanthus RhizosphereQFEVVGASKVAIHDGRIVKGAEERNGGKKKYFFMAPGEKYDLTKLERIGKPARGEP*
Ga0066701_1018243123300005552SoilKVAIHDGRSDPKAEERNGKKYFFMGAGEKYDLTKLEREKRPRTTEQ*
Ga0066695_1037641413300005553SoilGASKVAIHDGRIVKGAQERNGGKKKYFFMGPGEQYDLTKLERIGKPPRSEP*
Ga0068859_10109563113300005617Switchgrass RhizosphereAQERNGGKKKYFFMGPGEKYDLTKLERIGKPKPAEP*
Ga0068864_10025162213300005618Switchgrass RhizosphereAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPKPVEP*
Ga0068864_10242386213300005618Switchgrass RhizosphereAIHDGRIVKGAQERNGKKYFFMGPGEKYDLTKLEWIGKPKVSEQH*
Ga0068866_1006942833300005718Miscanthus RhizosphereESTAIVVQGQQFEVIGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLNKLERIGKPKPTEP*
Ga0066903_10147031433300005764Tropical Forest SoilVRGQEFEVAGASKIAVHDGRTVAAERQQRNNKQYFFMAPGERYDLTKLERIGKRAATEP*
Ga0066903_10295172213300005764Tropical Forest SoilGASKVAIHDGRSVPGEREQRNGKKYYFIGPGERYDLTKLERIGRVNRTEQQQ*
Ga0066903_10693767613300005764Tropical Forest SoilAIVVQGQQFEVIGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLNKLERIGKPKPAEP*
Ga0068863_10118718223300005841Switchgrass RhizosphereIGASKVAIHDGRIVKGAQERNGGRKKYFFMGPGEKYDLTKLERIGKPKPVEP*
Ga0068860_10078579313300005843Switchgrass RhizosphereQERNGGTKKYFFMGPGEKYDLTKLEPVGKRAASEQR*
Ga0068860_10190607513300005843Switchgrass RhizosphereGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLNKLERIGKPKPTEP*
Ga0068860_10211700113300005843Switchgrass RhizosphereGQQFEVIGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPKPAEP*
Ga0068860_10278785923300005843Switchgrass RhizosphereVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPRPTEP*
Ga0066651_1044791023300006031SoilIIVQGQQFEIVGASKVAIHDGRIVKGAQERNGKKYFFMGPGEKYDLTKLEWIGKPKVSEQH*
Ga0074060_1104902233300006604SoilIAIHDGRMVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPMPAEP*
Ga0075425_10045770623300006854Populus RhizosphereHDGRIVEKERQQRNGKKYFFMAPGERYDLTKLEPIGRRPASDQ*
Ga0075425_10057338613300006854Populus RhizosphereIVGASKVAIHDGRIVKGAQERNGKKYFFMGPGEKYDLTKLEWIGKPKVSEQH*
Ga0075434_10112545323300006871Populus RhizosphereVAIHDGRNVASERQQRNGKKYYFMAPGEKYDLTKLERIGKPKVSEQH*
Ga0068865_10077390913300006881Miscanthus RhizosphereVVRGQQFEVIGASKIAVHDGRIVKGAQERNGGRKKYFFMGPGEKYDLTKLEPVGKRAASEQR*
Ga0075426_1004330213300006903Populus RhizosphereQQRNGKKYFFMGPGDRYDLTTLQRIGGQPRTTEQ*
Ga0075424_10119992623300006904Populus RhizosphereQQRNGKKYYFMAPGERYNLTKLERVGRGNRSSEP*
Ga0075436_10081215513300006914Populus RhizosphereVPAERQQRNGKKYFFMGPGDRYDLTTLKRIGGQPRTTEQ*
Ga0099829_1037445813300009038Vadose Zone SoilKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPPRSER*
Ga0099828_1042125023300009089Vadose Zone SoilVVRGQQFEVIGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTRLERIGKPPGSER*
Ga0099828_1055498823300009089Vadose Zone SoilVVRGQQFEVIGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPARSEP*
Ga0099827_1140372923300009090Vadose Zone SoilHDGRLIESERQQRNGKKYYFMGPGEKYDLTRLERIGKRAATEP*
Ga0099827_1185400313300009090Vadose Zone SoilEITGASKVAIHDGRVVPGERQQRNGKKYYFMAPGERYDLTKLQKIGAQPRSTEQD*
Ga0105240_1080047123300009093Corn RhizosphereIVVHGQQFEVIGASKVAIHDGVSDPKSEARNGKKYFFMAPGEKYDLTKLERISSPKPSDGQ*
Ga0111539_1209225923300009094Populus RhizosphereAPPESTAIIVRGQKFEVVGASKIAIHDGRNVASERQQRNGKKYYFMGPGEKYDLTKLERIGKPKVSEQH*
Ga0114129_1070273813300009147Populus RhizosphereHDGRVVAGERQQRNGKKYFFMAPGERYDLTKLQRIGRVSTSEP*
Ga0105243_1058997213300009148Miscanthus RhizosphereQQFEVIGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPKPSEP*
Ga0075423_1030267613300009162Populus RhizosphereQQFEIAGASKVAIHDGRIVQSERQQRNGKKYFFMAPGERYDLTKLERIGRRPSNEPQG*
Ga0075423_1207243223300009162Populus RhizosphereQEFEITGASKVAIHDGRTVAGERQQRNGKKYYFMAPGERYNLTKLERVGRGNRSSEP*
Ga0105242_1153688423300009176Miscanthus RhizosphereVIGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTRLERIGKPKPAEP*
Ga0105242_1297163323300009176Miscanthus RhizosphereFEIVGASKVAIHDGRIVKGAQERNGKKYFFMGPGEKYDLTKLEWIGKPKVSEQH*
Ga0105248_1053346113300009177Switchgrass RhizosphereSKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTRLERIGKPKPAEP*
Ga0105248_1096840513300009177Switchgrass RhizosphereIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLNKLERIGKPKPTEP*
Ga0126384_1236636413300010046Tropical Forest SoilIHDGQNVASERQQRNGKKYYFMGPGEKYDLTKLERIGKPKVSEQH*
Ga0134070_1009377623300010301Grasslands SoilERNGGKKKYFFMGPGEQYDLTKLERIGKPPRSEP*
Ga0134062_1007460913300010337Grasslands SoilGRIVSGAQERNGGKKKYFFMGPGEQYDLTKLERIGKPPRSEP*
Ga0134127_1281336313300010399Terrestrial SoilAIHDGRIVKGAEERNGGKKKYFFMGPGEKYDLTKLERIGKPARSEP*
Ga0134122_1012354033300010400Terrestrial SoilESPAIVVRGPQFEVTGASKVAIHDGRIVEKERQQRNGKKYYFIGPGERYDLTKLERIGRPDRTEQP*
Ga0134122_1162520723300010400Terrestrial SoilSKIAIHDGRLVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPKPAEP*
Ga0134121_1201934823300010401Terrestrial SoilVQGQQFEVIGASKIAIHDGRIVKGAQERNGGKKKYFFMVPGEKYDLTKLERIGKPKPAEP
Ga0137388_1088786223300012189Vadose Zone SoilIVVRGQQFEVIGASKIAIHDGRLVESERQQRNGKKYYFMGPGEKYDLTKLERIGKRAATEP*
Ga0137372_1005920513300012350Vadose Zone SoilHDGRIVKGSQERNGKKYFFMGPGEKYDLTKLEWIGKPKVSEQH*
Ga0137394_1087863123300012922Vadose Zone SoilTGASKVAIHDGRLVEKERQQRNGKKYYFIGPGERYDLTKLERIGRPNRTEQP*
Ga0137407_1192215923300012930Vadose Zone SoilEFEVVGASKIAIHDGRLVAGERQQRNAKKYYFMGPGEKYDLTKLERIGKRAAAEP*
Ga0137407_1238992723300012930Vadose Zone SoilKGAQERNGGKKKYFFMGPGEKYDLTKLERVGKPGRSEP*
Ga0137410_1163549813300012944Vadose Zone SoilSTAIIVQGQQFEIVGASKVAIHDGRIVKGSQERNGKKYFFMGPGEKYDLTKLEWIGKPKVSEQH*
Ga0157374_1205712313300013296Miscanthus RhizosphereEVVGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERLGKPKPIEP*
Ga0157378_1017915113300013297Miscanthus RhizosphereKGAQERNGKKYFFMGPGEKYDLTKLEWIGKPKVSEQH*
Ga0134073_1010163613300015356Grasslands SoilFEVVGASKVAIHDGRSDPKAEERNGKKYFFMGPGEKYDLTKLEREKRPRTTEQ*
Ga0132258_1219034813300015371Arabidopsis RhizosphereIVRGQQFEIAGASKVAIHDGRVVATERQQRNGKKYFFMAPGERYDLTKLQRIGRVSTNEP
Ga0132258_1237145623300015371Arabidopsis RhizosphereGASKVAIHDGRVVTSERQQRNGKKYYFMAPGERYDLTKLARIGRQSASEP*
Ga0132256_10076190213300015372Arabidopsis RhizosphereESTAIIVQGQQFEIVGASKVAIHDGRIVKGAQERNGKKYFFMGPGEKYDLTKLEWIGKPKVSEQH*
Ga0182032_1144271123300016357SoilEIIGASKVAIHDGRSDPKAQERNFTKKYFFMGPGEKYDLTKLERINPRRSTEQH
Ga0182040_1038450813300016387SoilVTGQQFEIIGASKVAIHDGRSDPKAQERNFTKKYFFMGPGEKYDLTKLERINPRRSTEQH
Ga0134112_1051811523300017656Grasslands SoilAIHDGRIVKGAQERHGKKYFFMAPGERYDLTKLERIGKANRSEQP
Ga0213851_122449613300021860WatershedsIHDGRIVKGAQERNGGTKKYFFMGPGEKYDLTKLDRIGKPKPSEPQ
Ga0207642_1114452813300025899Miscanthus RhizosphereVRGQQFEITGASKVAIHDGRTVATEREQRNGKKYFFMAPGERYDLTKLQRIGRRTASEP
Ga0207663_1085431813300025916Corn, Switchgrass And Miscanthus RhizosphereIVVHGQQFEVIGASKVAIHDGVSDPKSEARNGKKYFFMAPGEKYDLTKLERISPPKPSDG
Ga0207662_1008615613300025918Switchgrass RhizosphereSKVAIHDGRIVKGAQERNGKKYFFMGPGEKYDLTKLEWIGKPKVSEQH
Ga0207649_1098302513300025920Corn RhizosphereAIVVQGQQFEVIGASKVAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPKPVEP
Ga0207681_1141058523300025923Switchgrass RhizosphereVRGQQFEVAGASKVAIHDGRAVPGERQQRNGKKYFFMAPGERYDLTKLQRIGRQAASEP
Ga0207686_1148790213300025934Miscanthus RhizosphereASKVAIHDGRIVKGAQERNGKKYFFMGPGEKYDLTKLEWIGKPKVSEQH
Ga0207709_1168431223300025935Miscanthus RhizosphereVQGQQFEVIGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPKPSEP
Ga0207691_1006795013300025940Miscanthus RhizosphereIIVRGQQFEIAGASKVAIHDGRAVASERQQRNGKKYFFMAPGERYDLTKLQRIGRQTPSE
Ga0207711_1012201113300025941Switchgrass RhizosphereIVVQGQQFEVIGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTRLERIGKPKPAEP
Ga0207689_1132681013300025942Miscanthus RhizosphereGQQFEVIGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLNKLERIGKPKPTEP
Ga0207703_1069057623300026035Switchgrass RhizosphereIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPKPSEP
Ga0207648_1114086613300026089Miscanthus RhizosphereTAIVVQGQQFEVIGASKVAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPKPVEP
Ga0207648_1224481413300026089Miscanthus RhizosphereSKIAIHDGRIVKGAQERNGGKKKYFFMGPGETYDLTKLERIGKRAPSEPR
Ga0207676_1152772713300026095Switchgrass RhizosphereAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPKPVEP
Ga0207674_1068163813300026116Corn RhizosphereIAIHDGRIVPSERQQRNGKKYYFMAPGEKYDLTKLERIGKRSSTEQ
Ga0209688_105626423300026305SoilIVRGQQLEITGASKIAVHDGRGLESERQQRNGKKYFFMAPGERYDLTKLERIGKRPAAEP
Ga0209686_103134013300026315SoilEVVGASKVAIHDGRSDPKAEERNGKKYFFMGPGEKYDLTKLEREKRPRTTEQ
Ga0209076_120804423300027643Vadose Zone SoilAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPARSEP
Ga0209177_1032541333300027775Agricultural SoilEFEIVGASKVAIHDGRAVKGAQERNGKKYYFMGPGERYDLTKLERVGKVTRSEQD
Ga0209168_1013704733300027986Surface SoilVRRQTFEVTGASKIAIHDGRDVPKERQQRNGKKYYFMGPGERYDLTKLQKIGARPQSTEQ
Ga0307279_1006540223300028709SoilKGAQERNAGKKKYFFMAPGEKYDLTTLERIGKKAPTEP
Ga0307504_1035062513300028792SoilSTAIVVQGQQFEIVGASKVAIHDGRIVKGSQERNGKKYFFMGPGEKYDLTKLEWIGKPKVSEQH
Ga0318541_1038302533300031545SoilVQGQQFEVIGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLNKLERIGKPKPAEP
Ga0307408_10072608723300031548RhizosphereGRIVKGAQERNGKKYFFMGPGEKYDLTKLEWIGKPKVTEQQ
Ga0307473_1141212823300031820Hardwood Forest SoilASKIAIHDGRIVKGAQERNGGRKKYFFMGPGEKYDLTKLERIGKPKPTEP
Ga0310892_1095443323300031858SoilESTAIIVRGQQFEITGASKVAIHDGRVVAGERQQRNGKKYFFMAPGERYDLTKLQRIGRQAASEP
Ga0306925_1060061913300031890SoilGRSDPKAQERNFTKKFFFMGPGEKYDLTKLERINPRRSTEQH
Ga0310895_1077071123300032122SoilIIVQGQQFEIVGASKVAIHDGRIVKGAQERNGKKYFFMGPGEKYDLTKLEWIGKAKVSEQ
Ga0315281_1132943213300032163SedimentSTAIVVQGQQFEVIGASKIAIHDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLERIGKPKPTEP
Ga0364945_0035058_2_1363300034115SedimentDGRIVKGAQERNGGKKKYFFMGPGEKYDLTKLEPIGKRAASEQH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.