NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F105057

Metagenome Family F105057

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105057
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 44 residues
Representative Sequence MKAKKKKLALPRRQWKINPVTRVKESGKKYSRPRVKRNAVPYEE
Number of Associated Samples 80
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 37.93 %
% of genes near scaffold ends (potentially truncated) 17.00 %
% of genes from short scaffolds (< 2000 bps) 60.00 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(16.000 % of family members)
Environment Ontology (ENVO) Unclassified
(47.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.28%    β-sheet: 0.00%    Coil/Unstructured: 84.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00551Formyl_trans_N 36.00
PF01634HisG 28.00
PF08029HisG_C 10.00
PF02452PemK_toxin 2.00
PF12799LRR_4 1.00
PF02653BPD_transp_2 1.00
PF06283ThuA 1.00
PF02894GFO_IDH_MocA_C 1.00
PF04014MazE_antitoxin 1.00
PF00291PALP 1.00
PF03602Cons_hypoth95 1.00
PF02518HATPase_c 1.00
PF13424TPR_12 1.00
PF00082Peptidase_S8 1.00
PF13229Beta_helix 1.00
PF13414TPR_11 1.00
PF01715IPPT 1.00
PF02540NAD_synthase 1.00
PF08213COX24_C 1.00
PF00581Rhodanese 1.00
PF13432TPR_16 1.00
PF02660G3P_acyltransf 1.00
PF01597GCV_H 1.00
PF00501AMP-binding 1.00
PF10459Peptidase_S46 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0040ATP phosphoribosyltransferaseAmino acid transport and metabolism [E] 38.00
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 2.00
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 1.00
COG0324tRNA A37 N6-isopentenylltransferase MiaATranslation, ribosomal structure and biogenesis [J] 1.00
COG0344Phospholipid biosynthesis protein PlsY, probable glycerol-3-phosphate acyltransferaseLipid transport and metabolism [I] 1.00
COG0509Glycine cleavage system protein H (lipoate-binding)Amino acid transport and metabolism [E] 1.00
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 1.00
COG074216S rRNA G966 N2-methylase RsmDTranslation, ribosomal structure and biogenesis [J] 1.00
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 1.00
COG2242Precorrin-6B methylase 2Coenzyme transport and metabolism [H] 1.00
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 1.00
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 1.00
COG4813Trehalose utilization proteinCarbohydrate transport and metabolism [G] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.00 %
UnclassifiedrootN/A28.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005530|Ga0070679_101823001All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300005541|Ga0070733_11204963All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005573|Ga0078972_1007354All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia24588Open in IMG/M
3300005591|Ga0070761_11036493Not Available521Open in IMG/M
3300005617|Ga0068859_100193292All Organisms → cellular organisms → Bacteria2119Open in IMG/M
3300006638|Ga0075522_10003428All Organisms → cellular organisms → Bacteria11558Open in IMG/M
3300009548|Ga0116107_1111514All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300009553|Ga0105249_13002308All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300009630|Ga0116114_1007225All Organisms → cellular organisms → Bacteria3803Open in IMG/M
3300009630|Ga0116114_1170228All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → Verrucomicrobium spinosum549Open in IMG/M
3300009637|Ga0116118_1215723Not Available597Open in IMG/M
3300009639|Ga0116122_1206285All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300009698|Ga0116216_10548302Not Available698Open in IMG/M
3300009700|Ga0116217_10377096All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300010341|Ga0074045_11084119All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300010379|Ga0136449_100029919All Organisms → cellular organisms → Bacteria13246Open in IMG/M
3300010379|Ga0136449_101785443All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300010401|Ga0134121_10743947All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300011999|Ga0120148_1002006All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula6973Open in IMG/M
3300012360|Ga0137375_11265290All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300014151|Ga0181539_1001832All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia22596Open in IMG/M
3300014151|Ga0181539_1066983All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1611Open in IMG/M
3300014159|Ga0181530_10154563Not Available1304Open in IMG/M
3300014160|Ga0181517_10167576All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1222Open in IMG/M
3300014160|Ga0181517_10267466All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula908Open in IMG/M
3300014162|Ga0181538_10587365All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula582Open in IMG/M
3300014494|Ga0182017_10389196Not Available864Open in IMG/M
3300014498|Ga0182019_10363194All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300014501|Ga0182024_10003815All Organisms → cellular organisms → Bacteria35329Open in IMG/M
3300014501|Ga0182024_10046645All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula6964Open in IMG/M
3300014501|Ga0182024_10455950All Organisms → cellular organisms → Bacteria1638Open in IMG/M
3300014501|Ga0182024_12047035All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula632Open in IMG/M
3300014839|Ga0182027_10008995All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula14433Open in IMG/M
3300014839|Ga0182027_10011631All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula12421Open in IMG/M
3300014839|Ga0182027_10110825All Organisms → cellular organisms → Bacteria3290Open in IMG/M
3300015203|Ga0167650_1025313All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300017929|Ga0187849_1171741All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula861Open in IMG/M
3300017931|Ga0187877_1361436All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula550Open in IMG/M
3300017935|Ga0187848_10002492All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula14420Open in IMG/M
3300017941|Ga0187850_10399441All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300017988|Ga0181520_10111363All Organisms → cellular organisms → Bacteria2315Open in IMG/M
3300018019|Ga0187874_10211338All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300018020|Ga0187861_10205516Not Available878Open in IMG/M
3300018026|Ga0187857_10407294All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin118613Open in IMG/M
3300018033|Ga0187867_10204040All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1123Open in IMG/M
3300018033|Ga0187867_10503331All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula666Open in IMG/M
3300018033|Ga0187867_10702535All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300018034|Ga0187863_10742790All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → Verrucomicrobium spinosum555Open in IMG/M
3300018040|Ga0187862_10597059Not Available654Open in IMG/M
3300018042|Ga0187871_10006395All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia8482Open in IMG/M
3300018044|Ga0187890_10624684Not Available607Open in IMG/M
3300018046|Ga0187851_10376171All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales815Open in IMG/M
3300018046|Ga0187851_10659553All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula590Open in IMG/M
3300018431|Ga0066655_10232444All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin1181164Open in IMG/M
3300019788|Ga0182028_1144993All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2968Open in IMG/M
3300023101|Ga0224557_1080810All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300023101|Ga0224557_1205242All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales682Open in IMG/M
3300025664|Ga0208849_1002087All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia11698Open in IMG/M
3300025862|Ga0209483_1000353All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales41666Open in IMG/M
3300027863|Ga0207433_10025183All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula7583Open in IMG/M
3300027905|Ga0209415_10085729All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3580Open in IMG/M
3300027905|Ga0209415_10373446All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1171Open in IMG/M
3300028379|Ga0268266_11131732Not Available757Open in IMG/M
3300028573|Ga0265334_10325248Not Available526Open in IMG/M
3300028759|Ga0302224_10495548Not Available500Open in IMG/M
3300028780|Ga0302225_10103604All Organisms → cellular organisms → Bacteria1390Open in IMG/M
3300028800|Ga0265338_10152752All Organisms → cellular organisms → Bacteria1792Open in IMG/M
3300028863|Ga0302218_10109739All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300030399|Ga0311353_10006431All Organisms → cellular organisms → Bacteria14817Open in IMG/M
3300030580|Ga0311355_11848857All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300031234|Ga0302325_11476508All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula878Open in IMG/M
3300031234|Ga0302325_13180311All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031236|Ga0302324_100004770All Organisms → cellular organisms → Bacteria29920Open in IMG/M
3300031236|Ga0302324_101642220All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula826Open in IMG/M
3300031251|Ga0265327_10002009All Organisms → cellular organisms → Bacteria22969Open in IMG/M
3300031708|Ga0310686_103027296All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula5756Open in IMG/M
3300031708|Ga0310686_111098648All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula905Open in IMG/M
3300031823|Ga0307478_11273471Not Available612Open in IMG/M
3300032829|Ga0335070_10636158Not Available1001Open in IMG/M
3300033402|Ga0326728_10005951All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula33507Open in IMG/M
3300033402|Ga0326728_10051137All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula6027Open in IMG/M
3300033405|Ga0326727_10732196Not Available781Open in IMG/M
3300033489|Ga0299912_10016088All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula6367Open in IMG/M
3300033977|Ga0314861_0215446All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → Verrucomicrobium spinosum900Open in IMG/M
3300033982|Ga0371487_0325643All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales684Open in IMG/M
3300034091|Ga0326724_0129728All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300034091|Ga0326724_0570240Not Available568Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland16.00%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa9.00%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog7.00%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.00%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen6.00%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil6.00%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.00%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost4.00%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.00%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.00%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.00%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.00%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.00%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.00%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005573Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly)EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011999Permafrost microbial communities from Nunavut, Canada - A28_65cm_6MEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015203Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025664Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300027863Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031251Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066673_1061931823300005175SoilMKKRKKTTWLPRRTWTINPVTRVKKSAKAYSRRRAQRKAGYEEA*
Ga0066679_1044061223300005176SoilMKKRKKKTLLPRRTWTINPVTRVKKSAKAYSRRRAQREAGYEEA*
Ga0070701_1101933623300005438Corn, Switchgrass And Miscanthus RhizosphereMKGKKKKLALPRRTWKINPVTRVKESARKYDRARTKHQWRKDGRA*
Ga0070679_10182300113300005530Corn RhizosphereMKPKKKKLALPRRQWTINPVTRVKESDKKYKRARVKQDVSKYEE*
Ga0070733_1120496323300005541Surface SoilMKAKKKKLTLPRRQWTINPVTRVKGSARKYDRARVRRQSRKDTSQ*
Ga0066704_1017169623300005557SoilMKKRKKKTLLPRRTWAINPVTRVKKSAKAYSRRRAQREAGYEEA*
Ga0066705_1050240623300005569SoilMKKRKKKTWLPRRTWTINPVTRVKKSAKAYSRRRAQRKAGYEEA*
Ga0078972_1007354203300005573Hot SpringMRVRKKKLALARRTWKINPVTRIKESAKTYSRPRAKRTVQTELGWE*
Ga0070761_1103649323300005591SoilMHMKVKKRKLVLPRRQWKISPVTRVKDSAKKYVRTKAKREIDPNES*
Ga0066706_1048153223300005598SoilMKKRKKKTWLPRRTWTINPVTRVKKSAKAYSRRRAQREAGYEEA*
Ga0070702_10105362313300005615Corn, Switchgrass And Miscanthus RhizosphereMKGKKKKLALPRRTWKINPVTRVKESARKYDRARTKHQWRKGDRA*
Ga0068859_10019329213300005617Switchgrass RhizosphereMKRKKKKSIALPRRSWQINPVTRVKTSAKTYSRSKNKK
Ga0075522_10003428123300006638Arctic Peat SoilMKKGKKTLALPRRSWTINPVTRVKDSAKKFSRARVKRDSQKNFE*
Ga0116107_111151423300009548PeatlandMKAKKKKLALPRRPWKINPVTRVKQSGKDYSRPRLKRDSARYEE*
Ga0105249_1300230823300009553Switchgrass RhizosphereMKRKKKKSIALPRRSWQINPVTRVKTSAKTYSRSKNK
Ga0116114_100722553300009630PeatlandMNAKKNKLALPRRQWKINPVTRVKESGKKYSRPRVKRVASRYEE*
Ga0116114_117022813300009630PeatlandKPRAAFRRAPRPMKAKKKKLALPRRPWKINPVTRVKQSGKDYSRPRLKRDSARYEE*
Ga0116118_121572313300009637PeatlandTLAAFRRAPRPMKAKKKKLALPRRPWKINPVTRVKQSGKDYSRPRLKRDSARYEE*
Ga0116122_120628523300009639PeatlandMKAKKKKLALPRRQWTINPVTRVKESGKKYSRPRVKRSALPYEE*
Ga0116216_1054830213300009698Peatlands SoilTLAALHPAMHPMKAKKKKLALPRRPWKINPVTRVKQSGKNYSRPRLKRDSARYEE*
Ga0116217_1037709623300009700Peatlands SoilMKDKKKKLALPRRSWKINPVTRVQESAKNYCRPRVKR
Ga0134064_1033303523300010325Grasslands SoilMKKRKKKTLVPRRTWTINPVTRVKKSAKAYSRRRAQREAGYEEA*
Ga0074045_1108411923300010341Bog Forest SoilMKAKKKKLALPRRQWKINPVTRVKQSGKNYSRPRVKRNAMPYEE*
Ga0136449_100029919103300010379Peatlands SoilMKAKKKKLALPRRPWKINPVTRVKQSGKNYSRPRLKRDSARYEE*
Ga0136449_10178544323300010379Peatlands SoilMKAKKKKLALPRRSWKINPVTRVQESAKNYCRPRVKRDRTRYEEQ*
Ga0134121_1074394723300010401Terrestrial SoilMNRKPKKKKVALPRRQWQINPVTRVKTSAKVYSRPRAKRGLENL*
Ga0120148_100200643300011999PermafrostVKAKKKKVALPRRQWKINPVTRVKDSAKKYLRPRAKRNLHDEE*
Ga0137374_1009278433300012204Vadose Zone SoilMKKWKQTPSLPRRTWTINPVTRVKLSARAYSRQRTQAERGKQRNEE*
Ga0137375_1060872223300012360Vadose Zone SoilMKKWKQTPSLPRRTWTINPVTRVKLSARAYSRQRTQAERGKQ
Ga0137375_1126529023300012360Vadose Zone SoilMKKRKKKISLPRRAWTINPVTRVKKSAKLYSRPRAKRNSSHEEE*
Ga0137419_1013724933300012925Vadose Zone SoilMKKRKKKTLLPRRTWTINPVTRVKKSAKAYSRRRAQRKAGYEEA*
Ga0181539_1001832173300014151BogMKAKKKKMALPRRPWKINPVTRVKESGKRYSRPRVKRSASRYEE*
Ga0181539_106698323300014151BogMNPAKIKKKKLALPRRSWKINPVTRVQVSGKSYSRPRVKRDRTRYEE*
Ga0134078_1053143623300014157Grasslands SoilMKKRKKKIGLPRRSWSINPVTRVKTSAKVYARQRAKRNSVHEA*
Ga0181530_1015456333300014159BogKKKKLALPRRKWKISPVTRVKGSDKQYSRSRAKHDPLPYAE*
Ga0181517_1016757623300014160BogMKAKKKKLALPRRQWKINPVTRVKESAKTYSRPRAKRNTTPHEE*
Ga0181517_1026746623300014160BogMKAKKKKLALPRRQWKINPVTRVKESGKNYSRPRAKHHAKPYEEE*
Ga0181538_1058736523300014162BogMKAKKKKMALPRRQWKISPLTRVKDSARKYSRPRAKRDRGRYDE*
Ga0182017_1038919623300014494FenPRRQWKINPVTRVKQSGKKYSRPRVKRKVMPYEE*
Ga0182019_1036319413300014498FenMKAKKKKLALPRRQWKINPVTRVKQSGKSYSRPRVKRNAMPYEE*
Ga0182024_10003815163300014501PermafrostMKVKKKKLALPRRQWKISPVTRVKASAKNYARAKARRELERNEP*
Ga0182024_1004664543300014501PermafrostMKARKKKLALPRQPWIINPKTRVKQSSKKYARPRAKRDAKQYE*
Ga0182024_1045595043300014501PermafrostMKVKKKKLALPRRQWKISPVTRVKQSAKSYARAKAKRDAERNES*
Ga0182024_1204703523300014501PermafrostMKTKKKKLALPRRQWKISPVTRVKQSAKKYTRTRLKRELGRVDE*
Ga0182027_1000899593300014839FenMKAKKKKLALPRRQWKINPVTRVKESGKRYSRPRVKRHAMPYEE*
Ga0182027_1001163193300014839FenMKARKKKLALPRRQWKINPITRVKESGKKYWRPRVKRNASQYEE*
Ga0182027_1011082523300014839FenVKTKKKKLALPRRQWKINPVTRVKQSGKRYSRLRVKRNAMPYEE*
Ga0167650_102531323300015203Glacier Forefield SoilMKKPKKKLALPRRSWQINPVTRVKESVKRYSRPGGKRHIRAALTHEE*
Ga0187849_117174123300017929PeatlandMKAKKKKLALPRRPWKINPVTRVKQSGKNYSRPRLKRDLTRYEES
Ga0187877_136143623300017931PeatlandMKAKKKKLALPRRQWTINPVTRVKESGKKYSRPRVKRSALPYEE
Ga0187848_1000249243300017935PeatlandMKAKKKKLALPRRPWKINPVTRVKQSGKDYSRPRLKRDSARYEE
Ga0187850_1039944113300017941PeatlandMKTKKKKLALPRRPWKINPVTRVKQSGKDYSRPRLKRDSARYEE
Ga0181520_1011136323300017988BogMKAKKKKLALPRRQWKIIPVTRVKESAKTYSRPRAKRNTTPHEE
Ga0187874_1021133823300018019PeatlandMKAKKKKLALPRRQWKINPVTRVKQSGKRYSRPRVKRNAMPYEE
Ga0187861_1020551623300018020PeatlandRPPCMKAKKKKLALPRRQWTINPVTRVKESGKKYSRPRVKRSALPYEE
Ga0187857_1040729413300018026PeatlandKLALPRRPWKINPVTRVKQSGKDYSRPRLKRDSARYEE
Ga0187867_1020404023300018033PeatlandMKAKKKKLALPRRQWKINPVTRVKESGKKYVRPRAKRNATPYEE
Ga0187867_1050333123300018033PeatlandMPNRAMNRVKIKKKKLALPRRSWKINPLTRVQKSGKSYSRPRAKRDRTRYEE
Ga0187867_1070253523300018033PeatlandMKAKKKKLALPRRQWKINPVTRVKESGKNYSRPRAKHHAKPYEEE
Ga0187863_1074279023300018034PeatlandMKAKKKKLALPRRQWKINPVTRVKQSGKKYSRPRVKRNAVTHEE
Ga0187862_1059705913300018040PeatlandKKKLALPRRQWKINPVTRVKQSGKSYSRPRVKRNAMPYEE
Ga0187871_1000639553300018042PeatlandMKAKKKKLALPRRQWKINPVTRVKESAKRYSRPRVKRNAVTHEE
Ga0187890_1062468423300018044PeatlandLALPRQSWKINPVTRAQVSGRNYSRPGFKRDRTRYEE
Ga0187851_1037617123300018046PeatlandMKAKKKKLALPRRQWKINPVTRVKESAKTYSRPRAKRNTTPHEE
Ga0187851_1065955323300018046PeatlandMKAKKKKLALPRRQWKINPVTRVKQSGKSYSRPRVKRNAMPYEE
Ga0066655_1023244423300018431Grasslands SoilMKARKKKVALPRRQWQINPVTKIKGSAKKYSRPRVKRAEHKLEREE
Ga0066669_1004996843300018482Grasslands SoilMKKRKKKTLLPRRTWTINPVTRVKKSAKAYSRRRAQRKAGYEEA
Ga0182028_114499323300019788FenMKARKKKLALPRRQWKINPITRVKESGKKYWRPRVKRNASQYEE
Ga0224557_108081023300023101SoilVKTKKKKLALPRRQWKINPVTRVKQSGKRYSRLRVKRNAMPYEE
Ga0224557_120524223300023101SoilVKKKKKKLALPRRQWKINPVTRVKQSGKTYSRPRAKRNVMPHEE
Ga0208849_1002087123300025664Arctic Peat SoilMKKGKKKLALPRRNWTINPVTRVKESAKKFSRPRVKRNLQKDIE
Ga0209483_1000353143300025862Arctic Peat SoilMKKGKKTLALPRRSWTINPVTRVKDSAKKFSRARVKRDSQKNFE
Ga0207433_1002518353300027863Hot SpringMRVRKKKLALARRTWKINPVTRIKESAKTYSRPRAKRTVQTELGWE
Ga0209415_1008572943300027905Peatlands SoilMKAKKKKLALPRRSWKINPVTRVQESAKNYCRPRVKRDRTRYEEQ
Ga0209415_1037344623300027905Peatlands SoilMHPMKAKKKKLALPRRPWKINPVTRVKQSGKNYSRPRLKRDSARYEE
Ga0268266_1113173223300028379Switchgrass RhizosphereMRTKPKKKKLALPRRQWTINPITRVEESDKKYKRTRVKQDVRKYEE
Ga0265334_1032524823300028573RhizosphereMKKGKKTLALPRRSWTINPVTRVKESAKKFSRARVKRNLQNNFE
Ga0302224_1049554823300028759PalsaAHMKAKKKKLALPRRQWKISPVTRVKASAKNYARAKAKREAERNEF
Ga0302225_1010360433300028780PalsaMKAKKKKLALPRRQWKISPVTRVKASAKNYARAKAKREAERNEF
Ga0265338_1015275233300028800RhizosphereMKKGKKTLALPRRSWTINPVTRVKESAKKFSRARVKRNLQHNFE
Ga0302218_1010973943300028863PalsaMAHMKAKKKKLALPRRQWKISPVTRVKASAKNYARAKAKREAERN
Ga0311353_1000643193300030399PalsaMAHMKAKKKKLALPRRQWKISPVTRVKASAKNYARAKAKREAERNEF
Ga0311355_1184885713300030580PalsaMAHMKAKKKKLALPRRQWKISPVTRVKASAKNYARAKAKREAE
Ga0302325_1147650823300031234PalsaMKAKKKKLALPRRQWKINPVTRVKDSGKKYVRPRVKRESSPYEE
Ga0302325_1318031123300031234PalsaMKTKKKKLALPRRQWKISPVTRVKQSAKKYARTRLKREVGRDDE
Ga0302324_10000477073300031236PalsaMKVKKKKLALPRRQWKISPVTRVKQSAKSYARAKAKRDAERNES
Ga0302324_10164222023300031236PalsaMKTKKKKLALPRRQWKISPVTRVKGSDKKYSRPRVKRDRLPYAE
Ga0265327_10002009263300031251RhizosphereMRKPEKKKLALPRQQWTINPVTRVKESDKKYSRARVKKTVSKYEE
Ga0310686_10302729643300031708SoilMKVKKKKLALPRRQWKISPVTRVKQSAKSYARAKAKRDAERNEF
Ga0310686_11109864823300031708SoilMKAKKKKLALPRRQWKISPVTRVKQSAKSYSRKRDGRDAGKNDE
Ga0307478_1127347123300031823Hardwood Forest SoilMKLKKKKLALPRRQWKISPVTRVKPSAKKYARTRAKRDLGRNDE
Ga0335070_1063615823300032829SoilVTLPMKKMKKKKLALPRRTWQINPVTRVKDSAKKYSRPRARLEIDRGLHR
Ga0326728_1000595163300033402Peat SoilMKAKKKKLALPRRQWKINPVTRVKQSGKNYSRPRVKRNAMPYEE
Ga0326728_1005113723300033402Peat SoilMKAKKKKLALPRRQWKINPVTRVKESGKKYSRPRVKRNAVPYEE
Ga0326727_1073219623300033405Peat SoilPLLMKAKKKKLALPRRQWKINPVTRVKESGKKYSRPRVKRNAVPYEE
Ga0299912_1001608833300033489SoilMNRKKKRLAFPRRTWKINPVTRVKESAKTYSRAGTKRAVRKMDYAE
Ga0314861_0215446_339_4793300033977PeatlandMKATMKKKKLALARQRWKINPVTRIKESARHYSRPRARRQAQRYEQ
Ga0371487_0325643_350_4813300033982Peat SoilMKRKKKMALPRRQWKISPLTRVKDSARKYSRPRAKRDRGRYDE
Ga0326724_0129728_1137_12833300034091Peat SoilVEESVKTKKKKLALPRRRWKISPVTRVKGSDKKYSRSRAKQDPLPYAE
Ga0326724_0570240_333_4793300034091Peat SoilVEESVKIKKKKLALPRRKWKISPVTRVKGSDKQYSRSRAKQDPLPYAE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.