| Basic Information | |
|---|---|
| Family ID | F105057 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MKAKKKKLALPRRQWKINPVTRVKESGKKYSRPRVKRNAVPYEE |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 37.93 % |
| % of genes near scaffold ends (potentially truncated) | 17.00 % |
| % of genes from short scaffolds (< 2000 bps) | 60.00 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (16.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.28% β-sheet: 0.00% Coil/Unstructured: 84.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00551 | Formyl_trans_N | 36.00 |
| PF01634 | HisG | 28.00 |
| PF08029 | HisG_C | 10.00 |
| PF02452 | PemK_toxin | 2.00 |
| PF12799 | LRR_4 | 1.00 |
| PF02653 | BPD_transp_2 | 1.00 |
| PF06283 | ThuA | 1.00 |
| PF02894 | GFO_IDH_MocA_C | 1.00 |
| PF04014 | MazE_antitoxin | 1.00 |
| PF00291 | PALP | 1.00 |
| PF03602 | Cons_hypoth95 | 1.00 |
| PF02518 | HATPase_c | 1.00 |
| PF13424 | TPR_12 | 1.00 |
| PF00082 | Peptidase_S8 | 1.00 |
| PF13229 | Beta_helix | 1.00 |
| PF13414 | TPR_11 | 1.00 |
| PF01715 | IPPT | 1.00 |
| PF02540 | NAD_synthase | 1.00 |
| PF08213 | COX24_C | 1.00 |
| PF00581 | Rhodanese | 1.00 |
| PF13432 | TPR_16 | 1.00 |
| PF02660 | G3P_acyltransf | 1.00 |
| PF01597 | GCV_H | 1.00 |
| PF00501 | AMP-binding | 1.00 |
| PF10459 | Peptidase_S46 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0040 | ATP phosphoribosyltransferase | Amino acid transport and metabolism [E] | 38.00 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 2.00 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 1.00 |
| COG0324 | tRNA A37 N6-isopentenylltransferase MiaA | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0344 | Phospholipid biosynthesis protein PlsY, probable glycerol-3-phosphate acyltransferase | Lipid transport and metabolism [I] | 1.00 |
| COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 1.00 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 1.00 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 1.00 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.00 % |
| Unclassified | root | N/A | 28.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005530|Ga0070679_101823001 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005541|Ga0070733_11204963 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005573|Ga0078972_1007354 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 24588 | Open in IMG/M |
| 3300005591|Ga0070761_11036493 | Not Available | 521 | Open in IMG/M |
| 3300005617|Ga0068859_100193292 | All Organisms → cellular organisms → Bacteria | 2119 | Open in IMG/M |
| 3300006638|Ga0075522_10003428 | All Organisms → cellular organisms → Bacteria | 11558 | Open in IMG/M |
| 3300009548|Ga0116107_1111514 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300009553|Ga0105249_13002308 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300009630|Ga0116114_1007225 | All Organisms → cellular organisms → Bacteria | 3803 | Open in IMG/M |
| 3300009630|Ga0116114_1170228 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → Verrucomicrobium spinosum | 549 | Open in IMG/M |
| 3300009637|Ga0116118_1215723 | Not Available | 597 | Open in IMG/M |
| 3300009639|Ga0116122_1206285 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300009698|Ga0116216_10548302 | Not Available | 698 | Open in IMG/M |
| 3300009700|Ga0116217_10377096 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300010341|Ga0074045_11084119 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010379|Ga0136449_100029919 | All Organisms → cellular organisms → Bacteria | 13246 | Open in IMG/M |
| 3300010379|Ga0136449_101785443 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300010401|Ga0134121_10743947 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300011999|Ga0120148_1002006 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 6973 | Open in IMG/M |
| 3300012360|Ga0137375_11265290 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300014151|Ga0181539_1001832 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 22596 | Open in IMG/M |
| 3300014151|Ga0181539_1066983 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1611 | Open in IMG/M |
| 3300014159|Ga0181530_10154563 | Not Available | 1304 | Open in IMG/M |
| 3300014160|Ga0181517_10167576 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 1222 | Open in IMG/M |
| 3300014160|Ga0181517_10267466 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 908 | Open in IMG/M |
| 3300014162|Ga0181538_10587365 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 582 | Open in IMG/M |
| 3300014494|Ga0182017_10389196 | Not Available | 864 | Open in IMG/M |
| 3300014498|Ga0182019_10363194 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300014501|Ga0182024_10003815 | All Organisms → cellular organisms → Bacteria | 35329 | Open in IMG/M |
| 3300014501|Ga0182024_10046645 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 6964 | Open in IMG/M |
| 3300014501|Ga0182024_10455950 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300014501|Ga0182024_12047035 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 632 | Open in IMG/M |
| 3300014839|Ga0182027_10008995 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 14433 | Open in IMG/M |
| 3300014839|Ga0182027_10011631 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 12421 | Open in IMG/M |
| 3300014839|Ga0182027_10110825 | All Organisms → cellular organisms → Bacteria | 3290 | Open in IMG/M |
| 3300015203|Ga0167650_1025313 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300017929|Ga0187849_1171741 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 861 | Open in IMG/M |
| 3300017931|Ga0187877_1361436 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 550 | Open in IMG/M |
| 3300017935|Ga0187848_10002492 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 14420 | Open in IMG/M |
| 3300017941|Ga0187850_10399441 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300017988|Ga0181520_10111363 | All Organisms → cellular organisms → Bacteria | 2315 | Open in IMG/M |
| 3300018019|Ga0187874_10211338 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300018020|Ga0187861_10205516 | Not Available | 878 | Open in IMG/M |
| 3300018026|Ga0187857_10407294 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin118 | 613 | Open in IMG/M |
| 3300018033|Ga0187867_10204040 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 1123 | Open in IMG/M |
| 3300018033|Ga0187867_10503331 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 666 | Open in IMG/M |
| 3300018033|Ga0187867_10702535 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300018034|Ga0187863_10742790 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → Verrucomicrobium spinosum | 555 | Open in IMG/M |
| 3300018040|Ga0187862_10597059 | Not Available | 654 | Open in IMG/M |
| 3300018042|Ga0187871_10006395 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 8482 | Open in IMG/M |
| 3300018044|Ga0187890_10624684 | Not Available | 607 | Open in IMG/M |
| 3300018046|Ga0187851_10376171 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 815 | Open in IMG/M |
| 3300018046|Ga0187851_10659553 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 590 | Open in IMG/M |
| 3300018431|Ga0066655_10232444 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin118 | 1164 | Open in IMG/M |
| 3300019788|Ga0182028_1144993 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2968 | Open in IMG/M |
| 3300023101|Ga0224557_1080810 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300023101|Ga0224557_1205242 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 682 | Open in IMG/M |
| 3300025664|Ga0208849_1002087 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 11698 | Open in IMG/M |
| 3300025862|Ga0209483_1000353 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 41666 | Open in IMG/M |
| 3300027863|Ga0207433_10025183 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 7583 | Open in IMG/M |
| 3300027905|Ga0209415_10085729 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3580 | Open in IMG/M |
| 3300027905|Ga0209415_10373446 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 1171 | Open in IMG/M |
| 3300028379|Ga0268266_11131732 | Not Available | 757 | Open in IMG/M |
| 3300028573|Ga0265334_10325248 | Not Available | 526 | Open in IMG/M |
| 3300028759|Ga0302224_10495548 | Not Available | 500 | Open in IMG/M |
| 3300028780|Ga0302225_10103604 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300028800|Ga0265338_10152752 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300028863|Ga0302218_10109739 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300030399|Ga0311353_10006431 | All Organisms → cellular organisms → Bacteria | 14817 | Open in IMG/M |
| 3300030580|Ga0311355_11848857 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031234|Ga0302325_11476508 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 878 | Open in IMG/M |
| 3300031234|Ga0302325_13180311 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031236|Ga0302324_100004770 | All Organisms → cellular organisms → Bacteria | 29920 | Open in IMG/M |
| 3300031236|Ga0302324_101642220 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 826 | Open in IMG/M |
| 3300031251|Ga0265327_10002009 | All Organisms → cellular organisms → Bacteria | 22969 | Open in IMG/M |
| 3300031708|Ga0310686_103027296 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 5756 | Open in IMG/M |
| 3300031708|Ga0310686_111098648 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 905 | Open in IMG/M |
| 3300031823|Ga0307478_11273471 | Not Available | 612 | Open in IMG/M |
| 3300032829|Ga0335070_10636158 | Not Available | 1001 | Open in IMG/M |
| 3300033402|Ga0326728_10005951 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 33507 | Open in IMG/M |
| 3300033402|Ga0326728_10051137 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 6027 | Open in IMG/M |
| 3300033405|Ga0326727_10732196 | Not Available | 781 | Open in IMG/M |
| 3300033489|Ga0299912_10016088 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula | 6367 | Open in IMG/M |
| 3300033977|Ga0314861_0215446 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → Verrucomicrobium spinosum | 900 | Open in IMG/M |
| 3300033982|Ga0371487_0325643 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 684 | Open in IMG/M |
| 3300034091|Ga0326724_0129728 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300034091|Ga0326724_0570240 | Not Available | 568 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 16.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 7.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.00% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 6.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 6.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 4.00% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.00% |
| Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.00% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005573 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPADES assembly) | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
| 3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027863 | Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066673_106193182 | 3300005175 | Soil | MKKRKKTTWLPRRTWTINPVTRVKKSAKAYSRRRAQRKAGYEEA* |
| Ga0066679_104406122 | 3300005176 | Soil | MKKRKKKTLLPRRTWTINPVTRVKKSAKAYSRRRAQREAGYEEA* |
| Ga0070701_110193362 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGKKKKLALPRRTWKINPVTRVKESARKYDRARTKHQWRKDGRA* |
| Ga0070679_1018230011 | 3300005530 | Corn Rhizosphere | MKPKKKKLALPRRQWTINPVTRVKESDKKYKRARVKQDVSKYEE* |
| Ga0070733_112049632 | 3300005541 | Surface Soil | MKAKKKKLTLPRRQWTINPVTRVKGSARKYDRARVRRQSRKDTSQ* |
| Ga0066704_101716962 | 3300005557 | Soil | MKKRKKKTLLPRRTWAINPVTRVKKSAKAYSRRRAQREAGYEEA* |
| Ga0066705_105024062 | 3300005569 | Soil | MKKRKKKTWLPRRTWTINPVTRVKKSAKAYSRRRAQRKAGYEEA* |
| Ga0078972_100735420 | 3300005573 | Hot Spring | MRVRKKKLALARRTWKINPVTRIKESAKTYSRPRAKRTVQTELGWE* |
| Ga0070761_110364932 | 3300005591 | Soil | MHMKVKKRKLVLPRRQWKISPVTRVKDSAKKYVRTKAKREIDPNES* |
| Ga0066706_104815322 | 3300005598 | Soil | MKKRKKKTWLPRRTWTINPVTRVKKSAKAYSRRRAQREAGYEEA* |
| Ga0070702_1010536231 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGKKKKLALPRRTWKINPVTRVKESARKYDRARTKHQWRKGDRA* |
| Ga0068859_1001932921 | 3300005617 | Switchgrass Rhizosphere | MKRKKKKSIALPRRSWQINPVTRVKTSAKTYSRSKNKK |
| Ga0075522_1000342812 | 3300006638 | Arctic Peat Soil | MKKGKKTLALPRRSWTINPVTRVKDSAKKFSRARVKRDSQKNFE* |
| Ga0116107_11115142 | 3300009548 | Peatland | MKAKKKKLALPRRPWKINPVTRVKQSGKDYSRPRLKRDSARYEE* |
| Ga0105249_130023082 | 3300009553 | Switchgrass Rhizosphere | MKRKKKKSIALPRRSWQINPVTRVKTSAKTYSRSKNK |
| Ga0116114_10072255 | 3300009630 | Peatland | MNAKKNKLALPRRQWKINPVTRVKESGKKYSRPRVKRVASRYEE* |
| Ga0116114_11702281 | 3300009630 | Peatland | KPRAAFRRAPRPMKAKKKKLALPRRPWKINPVTRVKQSGKDYSRPRLKRDSARYEE* |
| Ga0116118_12157231 | 3300009637 | Peatland | TLAAFRRAPRPMKAKKKKLALPRRPWKINPVTRVKQSGKDYSRPRLKRDSARYEE* |
| Ga0116122_12062852 | 3300009639 | Peatland | MKAKKKKLALPRRQWTINPVTRVKESGKKYSRPRVKRSALPYEE* |
| Ga0116216_105483021 | 3300009698 | Peatlands Soil | TLAALHPAMHPMKAKKKKLALPRRPWKINPVTRVKQSGKNYSRPRLKRDSARYEE* |
| Ga0116217_103770962 | 3300009700 | Peatlands Soil | MKDKKKKLALPRRSWKINPVTRVQESAKNYCRPRVKR |
| Ga0134064_103330352 | 3300010325 | Grasslands Soil | MKKRKKKTLVPRRTWTINPVTRVKKSAKAYSRRRAQREAGYEEA* |
| Ga0074045_110841192 | 3300010341 | Bog Forest Soil | MKAKKKKLALPRRQWKINPVTRVKQSGKNYSRPRVKRNAMPYEE* |
| Ga0136449_10002991910 | 3300010379 | Peatlands Soil | MKAKKKKLALPRRPWKINPVTRVKQSGKNYSRPRLKRDSARYEE* |
| Ga0136449_1017854432 | 3300010379 | Peatlands Soil | MKAKKKKLALPRRSWKINPVTRVQESAKNYCRPRVKRDRTRYEEQ* |
| Ga0134121_107439472 | 3300010401 | Terrestrial Soil | MNRKPKKKKVALPRRQWQINPVTRVKTSAKVYSRPRAKRGLENL* |
| Ga0120148_10020064 | 3300011999 | Permafrost | VKAKKKKVALPRRQWKINPVTRVKDSAKKYLRPRAKRNLHDEE* |
| Ga0137374_100927843 | 3300012204 | Vadose Zone Soil | MKKWKQTPSLPRRTWTINPVTRVKLSARAYSRQRTQAERGKQRNEE* |
| Ga0137375_106087222 | 3300012360 | Vadose Zone Soil | MKKWKQTPSLPRRTWTINPVTRVKLSARAYSRQRTQAERGKQ |
| Ga0137375_112652902 | 3300012360 | Vadose Zone Soil | MKKRKKKISLPRRAWTINPVTRVKKSAKLYSRPRAKRNSSHEEE* |
| Ga0137419_101372493 | 3300012925 | Vadose Zone Soil | MKKRKKKTLLPRRTWTINPVTRVKKSAKAYSRRRAQRKAGYEEA* |
| Ga0181539_100183217 | 3300014151 | Bog | MKAKKKKMALPRRPWKINPVTRVKESGKRYSRPRVKRSASRYEE* |
| Ga0181539_10669832 | 3300014151 | Bog | MNPAKIKKKKLALPRRSWKINPVTRVQVSGKSYSRPRVKRDRTRYEE* |
| Ga0134078_105314362 | 3300014157 | Grasslands Soil | MKKRKKKIGLPRRSWSINPVTRVKTSAKVYARQRAKRNSVHEA* |
| Ga0181530_101545633 | 3300014159 | Bog | KKKKLALPRRKWKISPVTRVKGSDKQYSRSRAKHDPLPYAE* |
| Ga0181517_101675762 | 3300014160 | Bog | MKAKKKKLALPRRQWKINPVTRVKESAKTYSRPRAKRNTTPHEE* |
| Ga0181517_102674662 | 3300014160 | Bog | MKAKKKKLALPRRQWKINPVTRVKESGKNYSRPRAKHHAKPYEEE* |
| Ga0181538_105873652 | 3300014162 | Bog | MKAKKKKMALPRRQWKISPLTRVKDSARKYSRPRAKRDRGRYDE* |
| Ga0182017_103891962 | 3300014494 | Fen | PRRQWKINPVTRVKQSGKKYSRPRVKRKVMPYEE* |
| Ga0182019_103631941 | 3300014498 | Fen | MKAKKKKLALPRRQWKINPVTRVKQSGKSYSRPRVKRNAMPYEE* |
| Ga0182024_1000381516 | 3300014501 | Permafrost | MKVKKKKLALPRRQWKISPVTRVKASAKNYARAKARRELERNEP* |
| Ga0182024_100466454 | 3300014501 | Permafrost | MKARKKKLALPRQPWIINPKTRVKQSSKKYARPRAKRDAKQYE* |
| Ga0182024_104559504 | 3300014501 | Permafrost | MKVKKKKLALPRRQWKISPVTRVKQSAKSYARAKAKRDAERNES* |
| Ga0182024_120470352 | 3300014501 | Permafrost | MKTKKKKLALPRRQWKISPVTRVKQSAKKYTRTRLKRELGRVDE* |
| Ga0182027_100089959 | 3300014839 | Fen | MKAKKKKLALPRRQWKINPVTRVKESGKRYSRPRVKRHAMPYEE* |
| Ga0182027_100116319 | 3300014839 | Fen | MKARKKKLALPRRQWKINPITRVKESGKKYWRPRVKRNASQYEE* |
| Ga0182027_101108252 | 3300014839 | Fen | VKTKKKKLALPRRQWKINPVTRVKQSGKRYSRLRVKRNAMPYEE* |
| Ga0167650_10253132 | 3300015203 | Glacier Forefield Soil | MKKPKKKLALPRRSWQINPVTRVKESVKRYSRPGGKRHIRAALTHEE* |
| Ga0187849_11717412 | 3300017929 | Peatland | MKAKKKKLALPRRPWKINPVTRVKQSGKNYSRPRLKRDLTRYEES |
| Ga0187877_13614362 | 3300017931 | Peatland | MKAKKKKLALPRRQWTINPVTRVKESGKKYSRPRVKRSALPYEE |
| Ga0187848_100024924 | 3300017935 | Peatland | MKAKKKKLALPRRPWKINPVTRVKQSGKDYSRPRLKRDSARYEE |
| Ga0187850_103994411 | 3300017941 | Peatland | MKTKKKKLALPRRPWKINPVTRVKQSGKDYSRPRLKRDSARYEE |
| Ga0181520_101113632 | 3300017988 | Bog | MKAKKKKLALPRRQWKIIPVTRVKESAKTYSRPRAKRNTTPHEE |
| Ga0187874_102113382 | 3300018019 | Peatland | MKAKKKKLALPRRQWKINPVTRVKQSGKRYSRPRVKRNAMPYEE |
| Ga0187861_102055162 | 3300018020 | Peatland | RPPCMKAKKKKLALPRRQWTINPVTRVKESGKKYSRPRVKRSALPYEE |
| Ga0187857_104072941 | 3300018026 | Peatland | KLALPRRPWKINPVTRVKQSGKDYSRPRLKRDSARYEE |
| Ga0187867_102040402 | 3300018033 | Peatland | MKAKKKKLALPRRQWKINPVTRVKESGKKYVRPRAKRNATPYEE |
| Ga0187867_105033312 | 3300018033 | Peatland | MPNRAMNRVKIKKKKLALPRRSWKINPLTRVQKSGKSYSRPRAKRDRTRYEE |
| Ga0187867_107025352 | 3300018033 | Peatland | MKAKKKKLALPRRQWKINPVTRVKESGKNYSRPRAKHHAKPYEEE |
| Ga0187863_107427902 | 3300018034 | Peatland | MKAKKKKLALPRRQWKINPVTRVKQSGKKYSRPRVKRNAVTHEE |
| Ga0187862_105970591 | 3300018040 | Peatland | KKKLALPRRQWKINPVTRVKQSGKSYSRPRVKRNAMPYEE |
| Ga0187871_100063955 | 3300018042 | Peatland | MKAKKKKLALPRRQWKINPVTRVKESAKRYSRPRVKRNAVTHEE |
| Ga0187890_106246842 | 3300018044 | Peatland | LALPRQSWKINPVTRAQVSGRNYSRPGFKRDRTRYEE |
| Ga0187851_103761712 | 3300018046 | Peatland | MKAKKKKLALPRRQWKINPVTRVKESAKTYSRPRAKRNTTPHEE |
| Ga0187851_106595532 | 3300018046 | Peatland | MKAKKKKLALPRRQWKINPVTRVKQSGKSYSRPRVKRNAMPYEE |
| Ga0066655_102324442 | 3300018431 | Grasslands Soil | MKARKKKVALPRRQWQINPVTKIKGSAKKYSRPRVKRAEHKLEREE |
| Ga0066669_100499684 | 3300018482 | Grasslands Soil | MKKRKKKTLLPRRTWTINPVTRVKKSAKAYSRRRAQRKAGYEEA |
| Ga0182028_11449932 | 3300019788 | Fen | MKARKKKLALPRRQWKINPITRVKESGKKYWRPRVKRNASQYEE |
| Ga0224557_10808102 | 3300023101 | Soil | VKTKKKKLALPRRQWKINPVTRVKQSGKRYSRLRVKRNAMPYEE |
| Ga0224557_12052422 | 3300023101 | Soil | VKKKKKKLALPRRQWKINPVTRVKQSGKTYSRPRAKRNVMPHEE |
| Ga0208849_100208712 | 3300025664 | Arctic Peat Soil | MKKGKKKLALPRRNWTINPVTRVKESAKKFSRPRVKRNLQKDIE |
| Ga0209483_100035314 | 3300025862 | Arctic Peat Soil | MKKGKKTLALPRRSWTINPVTRVKDSAKKFSRARVKRDSQKNFE |
| Ga0207433_100251835 | 3300027863 | Hot Spring | MRVRKKKLALARRTWKINPVTRIKESAKTYSRPRAKRTVQTELGWE |
| Ga0209415_100857294 | 3300027905 | Peatlands Soil | MKAKKKKLALPRRSWKINPVTRVQESAKNYCRPRVKRDRTRYEEQ |
| Ga0209415_103734462 | 3300027905 | Peatlands Soil | MHPMKAKKKKLALPRRPWKINPVTRVKQSGKNYSRPRLKRDSARYEE |
| Ga0268266_111317322 | 3300028379 | Switchgrass Rhizosphere | MRTKPKKKKLALPRRQWTINPITRVEESDKKYKRTRVKQDVRKYEE |
| Ga0265334_103252482 | 3300028573 | Rhizosphere | MKKGKKTLALPRRSWTINPVTRVKESAKKFSRARVKRNLQNNFE |
| Ga0302224_104955482 | 3300028759 | Palsa | AHMKAKKKKLALPRRQWKISPVTRVKASAKNYARAKAKREAERNEF |
| Ga0302225_101036043 | 3300028780 | Palsa | MKAKKKKLALPRRQWKISPVTRVKASAKNYARAKAKREAERNEF |
| Ga0265338_101527523 | 3300028800 | Rhizosphere | MKKGKKTLALPRRSWTINPVTRVKESAKKFSRARVKRNLQHNFE |
| Ga0302218_101097394 | 3300028863 | Palsa | MAHMKAKKKKLALPRRQWKISPVTRVKASAKNYARAKAKREAERN |
| Ga0311353_100064319 | 3300030399 | Palsa | MAHMKAKKKKLALPRRQWKISPVTRVKASAKNYARAKAKREAERNEF |
| Ga0311355_118488571 | 3300030580 | Palsa | MAHMKAKKKKLALPRRQWKISPVTRVKASAKNYARAKAKREAE |
| Ga0302325_114765082 | 3300031234 | Palsa | MKAKKKKLALPRRQWKINPVTRVKDSGKKYVRPRVKRESSPYEE |
| Ga0302325_131803112 | 3300031234 | Palsa | MKTKKKKLALPRRQWKISPVTRVKQSAKKYARTRLKREVGRDDE |
| Ga0302324_1000047707 | 3300031236 | Palsa | MKVKKKKLALPRRQWKISPVTRVKQSAKSYARAKAKRDAERNES |
| Ga0302324_1016422202 | 3300031236 | Palsa | MKTKKKKLALPRRQWKISPVTRVKGSDKKYSRPRVKRDRLPYAE |
| Ga0265327_1000200926 | 3300031251 | Rhizosphere | MRKPEKKKLALPRQQWTINPVTRVKESDKKYSRARVKKTVSKYEE |
| Ga0310686_1030272964 | 3300031708 | Soil | MKVKKKKLALPRRQWKISPVTRVKQSAKSYARAKAKRDAERNEF |
| Ga0310686_1110986482 | 3300031708 | Soil | MKAKKKKLALPRRQWKISPVTRVKQSAKSYSRKRDGRDAGKNDE |
| Ga0307478_112734712 | 3300031823 | Hardwood Forest Soil | MKLKKKKLALPRRQWKISPVTRVKPSAKKYARTRAKRDLGRNDE |
| Ga0335070_106361582 | 3300032829 | Soil | VTLPMKKMKKKKLALPRRTWQINPVTRVKDSAKKYSRPRARLEIDRGLHR |
| Ga0326728_100059516 | 3300033402 | Peat Soil | MKAKKKKLALPRRQWKINPVTRVKQSGKNYSRPRVKRNAMPYEE |
| Ga0326728_100511372 | 3300033402 | Peat Soil | MKAKKKKLALPRRQWKINPVTRVKESGKKYSRPRVKRNAVPYEE |
| Ga0326727_107321962 | 3300033405 | Peat Soil | PLLMKAKKKKLALPRRQWKINPVTRVKESGKKYSRPRVKRNAVPYEE |
| Ga0299912_100160883 | 3300033489 | Soil | MNRKKKRLAFPRRTWKINPVTRVKESAKTYSRAGTKRAVRKMDYAE |
| Ga0314861_0215446_339_479 | 3300033977 | Peatland | MKATMKKKKLALARQRWKINPVTRIKESARHYSRPRARRQAQRYEQ |
| Ga0371487_0325643_350_481 | 3300033982 | Peat Soil | MKRKKKMALPRRQWKISPLTRVKDSARKYSRPRAKRDRGRYDE |
| Ga0326724_0129728_1137_1283 | 3300034091 | Peat Soil | VEESVKTKKKKLALPRRRWKISPVTRVKGSDKKYSRSRAKQDPLPYAE |
| Ga0326724_0570240_333_479 | 3300034091 | Peat Soil | VEESVKIKKKKLALPRRKWKISPVTRVKGSDKQYSRSRAKQDPLPYAE |
| ⦗Top⦘ |