Basic Information | |
---|---|
Family ID | F105053 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 48 residues |
Representative Sequence | MNELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR |
Number of Associated Samples | 70 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 81.00 % |
% of genes near scaffold ends (potentially truncated) | 24.00 % |
% of genes from short scaffolds (< 2000 bps) | 66.00 % |
Associated GOLD sequencing projects | 65 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (69.000 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (28.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (55.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (43.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 59.74% β-sheet: 0.00% Coil/Unstructured: 40.26% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF05257 | CHAP | 15.00 |
PF09723 | Zn-ribbon_8 | 6.00 |
PF14279 | HNH_5 | 6.00 |
PF04586 | Peptidase_S78 | 2.00 |
PF01844 | HNH | 2.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 2.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.00 % |
Unclassified | root | N/A | 7.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_109902395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2234 | Open in IMG/M |
3300002408|B570J29032_109931051 | All Organisms → cellular organisms → Bacteria | 3072 | Open in IMG/M |
3300002835|B570J40625_100274994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1731 | Open in IMG/M |
3300002835|B570J40625_100300273 | All Organisms → Viruses → Predicted Viral | 1629 | Open in IMG/M |
3300002835|B570J40625_101242020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300004481|Ga0069718_16238162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1035 | Open in IMG/M |
3300004481|Ga0069718_16312878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1490 | Open in IMG/M |
3300005517|Ga0070374_10129426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1313 | Open in IMG/M |
3300005527|Ga0068876_10454981 | Not Available | 708 | Open in IMG/M |
3300005832|Ga0074469_10807134 | All Organisms → Viruses → Predicted Viral | 3534 | Open in IMG/M |
3300006639|Ga0079301_1002840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7492 | Open in IMG/M |
3300006639|Ga0079301_1010853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3388 | Open in IMG/M |
3300006802|Ga0070749_10664110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300006805|Ga0075464_10288959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
3300006862|Ga0079299_1078103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300007162|Ga0079300_10189196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300007708|Ga0102859_1001885 | All Organisms → Viruses → Predicted Viral | 4815 | Open in IMG/M |
3300007973|Ga0105746_1247520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300008113|Ga0114346_1060356 | All Organisms → Viruses → Predicted Viral | 1852 | Open in IMG/M |
3300008266|Ga0114363_1015636 | All Organisms → Viruses → Predicted Viral | 3443 | Open in IMG/M |
3300008266|Ga0114363_1063248 | All Organisms → Viruses → Predicted Viral | 1430 | Open in IMG/M |
3300008266|Ga0114363_1102730 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
3300008266|Ga0114363_1143531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
3300008266|Ga0114363_1166565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300008266|Ga0114363_1172021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
3300008266|Ga0114363_1176916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300008448|Ga0114876_1120390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1007 | Open in IMG/M |
3300008448|Ga0114876_1234712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
3300008450|Ga0114880_1015669 | All Organisms → Viruses → Predicted Viral | 3619 | Open in IMG/M |
3300008450|Ga0114880_1021578 | All Organisms → Viruses → Predicted Viral | 2991 | Open in IMG/M |
3300008450|Ga0114880_1030425 | All Organisms → Viruses → Predicted Viral | 2415 | Open in IMG/M |
3300008450|Ga0114880_1137744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
3300008450|Ga0114880_1143064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
3300009009|Ga0105105_10316585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
3300009081|Ga0105098_10291312 | Not Available | 782 | Open in IMG/M |
3300009082|Ga0105099_10694710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
3300009168|Ga0105104_10425652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300009168|Ga0105104_10467796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300009169|Ga0105097_10003453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7858 | Open in IMG/M |
3300009169|Ga0105097_10369659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
3300011114|Ga0151515_10672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14404 | Open in IMG/M |
3300011334|Ga0153697_1427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12839 | Open in IMG/M |
3300012666|Ga0157498_1000989 | Not Available | 5185 | Open in IMG/M |
3300012709|Ga0157608_1068845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300012725|Ga0157610_1176610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300012730|Ga0157602_1181444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300013004|Ga0164293_10002816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14780 | Open in IMG/M |
3300013004|Ga0164293_10630945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
3300013310|Ga0157622_1204773 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300019122|Ga0188839_1011025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
3300020159|Ga0211734_10251184 | All Organisms → Viruses → Predicted Viral | 1942 | Open in IMG/M |
3300020160|Ga0211733_10688138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3907 | Open in IMG/M |
3300020161|Ga0211726_10565423 | All Organisms → Viruses → Predicted Viral | 3587 | Open in IMG/M |
3300020506|Ga0208091_1005680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1674 | Open in IMG/M |
3300020533|Ga0208364_1014399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1158 | Open in IMG/M |
3300020549|Ga0207942_1007563 | All Organisms → Viruses → Predicted Viral | 1514 | Open in IMG/M |
3300020553|Ga0208855_1011707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1420 | Open in IMG/M |
3300021438|Ga0213920_1002075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10046 | Open in IMG/M |
3300021952|Ga0213921_1009779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1796 | Open in IMG/M |
3300021961|Ga0222714_10111867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1704 | Open in IMG/M |
3300023184|Ga0214919_10616885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300027499|Ga0208788_1011248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3233 | Open in IMG/M |
3300027518|Ga0208787_1015142 | All Organisms → Viruses → Predicted Viral | 2595 | Open in IMG/M |
3300027721|Ga0209492_1001210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7995 | Open in IMG/M |
3300027721|Ga0209492_1001322 | Not Available | 7671 | Open in IMG/M |
3300027721|Ga0209492_1002543 | All Organisms → cellular organisms → Bacteria | 5734 | Open in IMG/M |
3300027756|Ga0209444_10037798 | All Organisms → Viruses → Predicted Viral | 2258 | Open in IMG/M |
3300027792|Ga0209287_10410666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300027805|Ga0209229_10021343 | All Organisms → Viruses → Predicted Viral | 2797 | Open in IMG/M |
3300027900|Ga0209253_10473880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
3300027900|Ga0209253_10989409 | Not Available | 582 | Open in IMG/M |
3300027956|Ga0209820_1083804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
3300031565|Ga0307379_10573596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1039 | Open in IMG/M |
3300031787|Ga0315900_10662300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
3300031857|Ga0315909_10012494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8890 | Open in IMG/M |
3300031857|Ga0315909_10040773 | All Organisms → Viruses → Predicted Viral | 4394 | Open in IMG/M |
3300031857|Ga0315909_10061032 | All Organisms → Viruses → Predicted Viral | 3426 | Open in IMG/M |
3300031857|Ga0315909_10233597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1426 | Open in IMG/M |
3300031963|Ga0315901_11101014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300033981|Ga0334982_0134052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1276 | Open in IMG/M |
3300033993|Ga0334994_0045970 | Not Available | 2749 | Open in IMG/M |
3300033996|Ga0334979_0057610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2502 | Open in IMG/M |
3300033996|Ga0334979_0247790 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
3300033996|Ga0334979_0494460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300033996|Ga0334979_0528707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300034012|Ga0334986_0031039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3529 | Open in IMG/M |
3300034012|Ga0334986_0231017 | All Organisms → Viruses → Predicted Viral | 1016 | Open in IMG/M |
3300034061|Ga0334987_0550706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
3300034062|Ga0334995_0034799 | Not Available | 4281 | Open in IMG/M |
3300034066|Ga0335019_0001729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14273 | Open in IMG/M |
3300034068|Ga0334990_0566911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300034092|Ga0335010_0565091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300034104|Ga0335031_0461588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
3300034106|Ga0335036_0165395 | All Organisms → Viruses → Predicted Viral | 1562 | Open in IMG/M |
3300034119|Ga0335054_0685698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300034122|Ga0335060_0339846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
3300034122|Ga0335060_0558792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300034166|Ga0335016_0596817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300034168|Ga0335061_0204988 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
3300034283|Ga0335007_0011940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6896 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 28.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 12.00% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.00% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.00% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 6.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.00% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.00% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.00% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.00% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.00% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.00% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 1.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.00% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.00% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.00% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.00% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.00% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006862 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 | Environmental | Open in IMG/M |
3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012709 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013310 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1099023952 | 3300002408 | Freshwater | MTSSELGLFVLMAIAGILWAAMSYSVGYREGQREGFKRGRAVSRHASREVR* |
B570J29032_1099310518 | 3300002408 | Freshwater | MNELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKEVR* |
B570J40625_1002749944 | 3300002835 | Freshwater | MTSSELGLFVLMAIAGILWAAMSYSVGYREGQREGFKRGRAVSRHAAKDVR* |
B570J40625_1003002734 | 3300002835 | Freshwater | FMAVAGILWAAISYSVGYREGERRGYLRARSIARHAAKEVK* |
B570J40625_1012420202 | 3300002835 | Freshwater | MNELSIVVFMAVAGILWAAISYSVGYREGERRGYLRARSIARHAAKEVK* |
Ga0069718_162381622 | 3300004481 | Sediment | MNELGIFVAMSIGAILWATMTYSVGYREGQREGFKRGRAISRHAAKDVK* |
Ga0069718_163128782 | 3300004481 | Sediment | MNELGIVVAMSIAAILWAAMSYSVGYREGQREGFKRGRAVSRHAAKEVR* |
Ga0070374_101294262 | 3300005517 | Freshwater Lake | MNELSIVVAMSIAAILWAAMSYSVGYREGERRGYSRARSLARHAARDVK* |
Ga0068876_104549812 | 3300005527 | Freshwater Lake | MNELSIVIFMLIAGVLWAAVSYSVGYREGQREGFKRGRAVSRHAAKDVR* |
Ga0074469_108071346 | 3300005832 | Sediment (Intertidal) | MNELGIIVAMSIAAILWAAMSYSVGYREGQREGFKRGRAVSRHAAKEVR* |
Ga0079301_10028406 | 3300006639 | Deep Subsurface | MNELSIVIFMLVAGLLWSAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR* |
Ga0079301_10108534 | 3300006639 | Deep Subsurface | MNELSIIVMMSIAALLWATMTYSVGYREGERRGYARGRAVSRHASKEVR* |
Ga0070749_106641102 | 3300006802 | Aqueous | MNELGIVVAMGIAAILWAAMSYSVGYREGQREGFKRGRAVSRHAAKEVR* |
Ga0075464_102889592 | 3300006805 | Aqueous | MNELGIVVAMGIAAILWAAMSYSVGYKEGQREGFKRGRAVSRHASREVR* |
Ga0079299_10781031 | 3300006862 | Deep Subsurface | QQMNELSIVIFMLVAGLLWSAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR* |
Ga0079300_101891962 | 3300007162 | Deep Subsurface | MNELSIIVMMSIAALLWATMTYSVGYREGERRGYARGRAVSRHAAKEVR* |
Ga0102859_10018858 | 3300007708 | Estuarine | MTSSELGLFVLMAIAGILWAAMSYSVGFREGQREGFKRGRAVSRHAAKDVR* |
Ga0105746_12475201 | 3300007973 | Estuary Water | MNELSIVVVMSIAAILWAAISYSVGYREGERRGYSRARSLARHAAKEVK* |
Ga0114346_10603562 | 3300008113 | Freshwater, Plankton | MNELSIVIFMLIAGILWAAMSYSVGYREGQREGFKRGRAVSRHAAKDVR* |
Ga0114363_10156366 | 3300008266 | Freshwater, Plankton | MNELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR* |
Ga0114363_10632481 | 3300008266 | Freshwater, Plankton | IVVFMAVAGILWAAISYSVGYREGERRGYLRARSIARHAAKEVK* |
Ga0114363_11027301 | 3300008266 | Freshwater, Plankton | MMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR* |
Ga0114363_11435312 | 3300008266 | Freshwater, Plankton | MNELSIVVFMAVAGILWAAISYSVGYREGERRGYLRARSIARHAAKDVK* |
Ga0114363_11665652 | 3300008266 | Freshwater, Plankton | MNELSIVVFMAVAGILWAAISYSVGYREGERRGYLRARSLARHAAKEVK* |
Ga0114363_11720211 | 3300008266 | Freshwater, Plankton | MDELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAA |
Ga0114363_11769161 | 3300008266 | Freshwater, Plankton | MDELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGLAVSRHAAKDV |
Ga0114876_11203902 | 3300008448 | Freshwater Lake | MNELSIVIAMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR* |
Ga0114876_12347121 | 3300008448 | Freshwater Lake | LGLFVLMAIAGILWAAMSYSVGYREGQREGFKRGRAVSRHAAKDVR* |
Ga0114880_10156696 | 3300008450 | Freshwater Lake | MNELGIVVAMSIAAILWAATSYSVGYREGQREGFKRGRAISRHAAKEVK* |
Ga0114880_10215783 | 3300008450 | Freshwater Lake | MNELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHASREVR* |
Ga0114880_10304251 | 3300008450 | Freshwater Lake | IFMLIAGVLWAAVSYSVGYREGQREGFKRGRAVSRHAAKDVR* |
Ga0114880_11377442 | 3300008450 | Freshwater Lake | MDELSIIVMMLIAGILWAAMSYSVGYKEGQREGFNRGRAVSRHAAKDVR* |
Ga0114880_11430642 | 3300008450 | Freshwater Lake | MNELSIVVFMAVAGILWSAISYSVGYREGERRGYLRARSIARHAAKEVK* |
Ga0105105_103165852 | 3300009009 | Freshwater Sediment | MNELGIVVAMSIAAILWAAMSYSVGYREGQREGFKRGRPISRHAAKDVR* |
Ga0105098_102913121 | 3300009081 | Freshwater Sediment | LIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKEVK* |
Ga0105099_106947102 | 3300009082 | Freshwater Sediment | MNELGIFVAMSIAAILWAAMSYSVGYREGEREGFKRGRAISRHAAKDVK* |
Ga0105104_104256521 | 3300009168 | Freshwater Sediment | MNELSIVIAMLVAGTLWSAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR* |
Ga0105104_104677962 | 3300009168 | Freshwater Sediment | MTSSELGLFVLMAIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR* |
Ga0105097_100034538 | 3300009169 | Freshwater Sediment | MNELSIVIMMIIAGIFWAAMSYSVGYREGQREGFKRGRAVSRHAAKDVR* |
Ga0105097_103696593 | 3300009169 | Freshwater Sediment | MNELSIIVMMLIAGILWAAMSYSVGYREGQREGFKRGRAVSRHAAK |
Ga0151515_1067217 | 3300011114 | Freshwater | MNEISIVIVMSIAAILWAAITYSVGYKEGERVGFSRGRAVTRHLSSRDKAAN* |
Ga0153697_142715 | 3300011334 | Freshwater | MNELSIVIAMSIAALLWAVSSYAVGYKEGQREGYRRGRAVTRHISQINSEVK* |
Ga0157498_10009896 | 3300012666 | Freshwater, Surface Ice | MNELSIVVFMSIAGILWAAMSYSVGYREGERRGYSRARSLARHAARDVK* |
Ga0157608_10688452 | 3300012709 | Freshwater | VVFMAVAGILWAAISYSVGYREGERRGYLRARSIARHAAKEVK* |
Ga0157610_11766102 | 3300012725 | Freshwater | RSQYREQVMNELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR* |
Ga0157602_11814442 | 3300012730 | Freshwater | RSQYRELVMNELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR* |
Ga0164293_1000281613 | 3300013004 | Freshwater | MNELSIIVMMLIAGILWSAMSYSVGYKEGQREGFKRGRAISRHAAKDVR* |
Ga0164293_106309451 | 3300013004 | Freshwater | MNELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKEVK* |
Ga0157622_12047732 | 3300013310 | Freshwater | VMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR* |
Ga0188839_10110252 | 3300019122 | Freshwater Lake | MGTTELSIIIMMSVAGFLWALMSYSVGYKQGQREGYARGRAVSRHMSAVSK |
Ga0211734_102511844 | 3300020159 | Freshwater | MTSSELGLFVLMAIAGILWAAMSYSVGFREGQREGFKRGRAVSRHAAKDVR |
Ga0211733_106881387 | 3300020160 | Freshwater | MNELSIVVIMTIAAILWAAITYSIGYKEGQREGFTRGRAISRHISASKKDVK |
Ga0211726_105654233 | 3300020161 | Freshwater | MNELSIVVFMSVAAILWAAISYSVGYREGERRGYSRARSLARHAAKDVR |
Ga0208091_10056805 | 3300020506 | Freshwater | MTSSELGLFVLMAIAGILWAAMSYSVGYREGQREGFKRGRAVSRHAAKDVR |
Ga0208364_10143992 | 3300020533 | Freshwater | MNELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKEVR |
Ga0207942_10075634 | 3300020549 | Freshwater | MTSSELGLFVLMAIAGILWAAMSYSVGYREGQREGFKRGRAVSRQAAKEVR |
Ga0208855_10117071 | 3300020553 | Freshwater | MDELSIIVMMLIAGILWSAMSYSVGYKEGQREGFRRGRAVSRHAAKDVR |
Ga0213920_100207513 | 3300021438 | Freshwater | VADNISIIVIMSIAAILWAAITYSVGYKEGERVGFTRGRAVSRHISSSDKAVK |
Ga0213921_10097795 | 3300021952 | Freshwater | MNELSIVVAMTLAAILWAAVSYSVGYKEGERVGFTRGRAISRHISSSKKAVK |
Ga0222714_101118673 | 3300021961 | Estuarine Water | MNELSIVIAMSIAALLWAVSSYAVGYREGQREGYRRGRAVTRHISQINSEVK |
Ga0214919_106168851 | 3300023184 | Freshwater | MNELSIVVAMTLAAILWAAVSYSVGYKEGERIGFTRGRAISRHISSSNKAVK |
Ga0208788_10112487 | 3300027499 | Deep Subsurface | MNELSIIVMMSIAALLWATMTYSVGYREGERRGYARGRAVSRHASKEVR |
Ga0208787_10151428 | 3300027518 | Deep Subsurface | MNELSIVIFMLVAGLLWSAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR |
Ga0209492_10012102 | 3300027721 | Freshwater Sediment | MNELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHASREVR |
Ga0209492_10013228 | 3300027721 | Freshwater Sediment | MMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR |
Ga0209492_10025439 | 3300027721 | Freshwater Sediment | MMIIAGIFWAAMSYSVGYREGQREGFKRGRAVSRHAAKDVR |
Ga0209444_100377986 | 3300027756 | Freshwater Lake | MSIAAILWAAMSYSVGYREGERRGYSRARSLARHAARDVK |
Ga0209287_104106661 | 3300027792 | Freshwater Sediment | MNELGIFVAMSIAAILWAAMSYSVGYREGEREGFKRGRAISRHAAKDVK |
Ga0209229_100213437 | 3300027805 | Freshwater And Sediment | MNELGIVVAMSIAAILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR |
Ga0209253_104738802 | 3300027900 | Freshwater Lake Sediment | MDELSIIVMMSIAALLWAVMSYSVGYKEGQREGYRRGRAVTRHISQINSEVK |
Ga0209253_109894092 | 3300027900 | Freshwater Lake Sediment | MTSSELGLFVLMAIAGILWAAMSYSVGYKEGQREGFKRGRSIARHATKEVR |
Ga0209820_10838042 | 3300027956 | Freshwater Sediment | MNELSIVIFMLIAGILWAAMSYSVGYREGQREGFKRGRAVSRHAAKDVR |
Ga0307379_105735961 | 3300031565 | Soil | MGTTELSIIIMMSIAGFLWALMSYSVGYKQGQREGYARGRAVSRHMSAVSK |
Ga0315900_106623002 | 3300031787 | Freshwater | MNELSIVIFMLIAGVLWAAVSYSVGYREGQREGFKRGRAVSRHAAKDVR |
Ga0315909_1001249410 | 3300031857 | Freshwater | MNELSIVIAMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR |
Ga0315909_100407737 | 3300031857 | Freshwater | MNELSIVVFMAVAGILWAAISYSVGYREGERRGYLRARSIARHAAKDVK |
Ga0315909_100610327 | 3300031857 | Freshwater | MNELSIVVFMAVAGILWAAISYSVGYREGERRGYLRARSLARHAAKEVK |
Ga0315909_102335972 | 3300031857 | Freshwater | MDELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR |
Ga0315901_111010141 | 3300031963 | Freshwater | MNELSIVIFMLIAGILWAAMSYSVGYREGQREGFKRGRAVSRHAAKD |
Ga0334982_0134052_973_1122 | 3300033981 | Freshwater | MNELSIVVVMSIAALLWATMTYSVGYREGERRGYARGRAVSRHAAKDVR |
Ga0334994_0045970_1874_2023 | 3300033993 | Freshwater | MNELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRQAAKEVR |
Ga0334979_0057610_1501_1650 | 3300033996 | Freshwater | MNELSIIVMMLIAGILWSAMSYSVGYKEGQREGFKRGRAISRHAAKDVR |
Ga0334979_0247790_889_1029 | 3300033996 | Freshwater | LGLFVLMAIAGILWAAMSYSVGYREGQREGFKRGRAVSRHAAKDVR |
Ga0334979_0494460_442_591 | 3300033996 | Freshwater | MNELSIVVFMAVAGILWSAISYSVGYREGERRGYSRGRAISRHAAKEVK |
Ga0334979_0528707_136_285 | 3300033996 | Freshwater | MNELTIVIAMSIAAILWSAMSYSVGYREGQREGFKRGRAISRHAAKDVR |
Ga0334986_0031039_359_508 | 3300034012 | Freshwater | MNELSIIVMMSIAALLWATMTYSVGYREGERRGYARGRAVSRHAAKEVR |
Ga0334986_0231017_2_124 | 3300034012 | Freshwater | MAIAGIFWAAMSYSVGYREGQREGFKRGRAVSRHAAKDVR |
Ga0334987_0550706_85_240 | 3300034061 | Freshwater | MTSSELGLFVLMAIAGILWAAMSYSVGYREGQREGFKRGRAVSRHATKDVR |
Ga0334995_0034799_2409_2558 | 3300034062 | Freshwater | MNELSIVVVMSIAALLWATMTYSVGYREGERRGYARGRAVSRHAAKDAR |
Ga0335019_0001729_5679_5834 | 3300034066 | Freshwater | MTSSELGLFVLMAIAGIFWAAMSYSVGYREGQREGFKRGRAVSRHAAKDVR |
Ga0334990_0566911_1_141 | 3300034068 | Freshwater | LGIVVTMSIAAMLWAAMTYSVGYKEGQREGFKRGRAVSRHAAKDVR |
Ga0335010_0565091_462_584 | 3300034092 | Freshwater | MLIAGILWSAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR |
Ga0335031_0461588_419_568 | 3300034104 | Freshwater | MNELSIVIAMLIAGILWSAMSYSVGYKEGQREGFKRGRAVSRHAAKDVR |
Ga0335036_0165395_571_720 | 3300034106 | Freshwater | MNELSIVIFMGIGAILWSLMSYSVGYKEGQREGFKRGRAVSRHAVKDVR |
Ga0335054_0685698_36_185 | 3300034119 | Freshwater | MNELGIFVAMSIAAILWAAMSYSVGYREGQREGFKRGRAVSRHAAKEVR |
Ga0335060_0339846_662_808 | 3300034122 | Freshwater | SELGLFVLMAIAGILWAAMSYSVGYREGQREGFKRGRAVSRHAAKDVR |
Ga0335060_0558792_1_147 | 3300034122 | Freshwater | MTSSELGLFVLMAIAGILWATMSYSVGYREGQREGFKRGRAVSRHAAKD |
Ga0335016_0596817_2_145 | 3300034166 | Freshwater | MNELSIIVMMLIAGILWAAMSYSVGYKEGQREGFKRGRAVSRHAAKEV |
Ga0335061_0204988_51_200 | 3300034168 | Freshwater | MNELGIVVTMSIAAMLWAAMTYSVGYKEGQREGFKRGRAVSRHAAKDVR |
Ga0335007_0011940_6013_6162 | 3300034283 | Freshwater | MNELSIVVVMSVAALLWATMTYSVGYREGERRGYARGRAVSRHAAKEVR |
⦗Top⦘ |