 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F105051 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MTISGYKKAIAKLLKAYHKKWDCFGKERKKNGSKKSRT |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 67.02 % |
| % of genes near scaffold ends (potentially truncated) | 9.00 % |
| % of genes from short scaffolds (< 2000 bps) | 64.00 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (83.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (24.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.27% β-sheet: 3.03% Coil/Unstructured: 69.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF05050 | Methyltransf_21 | 13.00 |
| PF08291 | Peptidase_M15_3 | 6.00 |
| PF08241 | Methyltransf_11 | 3.00 |
| PF00961 | LAGLIDADG_1 | 3.00 |
| PF01370 | Epimerase | 3.00 |
| PF13578 | Methyltransf_24 | 3.00 |
| PF02675 | AdoMet_dc | 2.00 |
| PF01832 | Glucosaminidase | 2.00 |
| PF03592 | Terminase_2 | 2.00 |
| PF00011 | HSP20 | 1.00 |
| PF03237 | Terminase_6N | 1.00 |
| PF11351 | GTA_holin_3TM | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 2.00 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 2.00 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 83.00 % |
| All Organisms | root | All Organisms | 17.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 24.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 10.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.00% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 6.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.00% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.00% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.00% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.00% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.00% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.00% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.00% |
| Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 1.00% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.00% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.00% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002206 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - OCT 2012 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006862 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011338 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Haengju | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024490 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| metazooDRAFT_13134463 | 3300002206 | Lake | MTFNNYKKTIAKLLKAYHKKYDAFGKKKNGSKKSRT* |
| B570J29032_1090784862 | 3300002408 | Freshwater | MTVSGYKRAIAKLLKAYHKKWDCFGNKKNGSKKSRT* |
| B570J29032_1094542852 | 3300002408 | Freshwater | MTISGYKKAISKLLKAYHKKWDCFGKEKKKNGSKKSRT* |
| Ga0070374_100326629 | 3300005517 | Freshwater Lake | MTLSGYKKSIAKLLKAYHKKFDCFGKRKNGSKKT* |
| Ga0049081_102604123 | 3300005581 | Freshwater Lentic | MTVSGYKRAIAKLLKAYRKKYDAFGKERPKKRKRIK* |
| Ga0049084_101657213 | 3300005585 | Freshwater Lentic | MTVSGYKKAIAKLLKAYRKKYDAFGKERPKKRKRIK* |
| Ga0079957_10168223 | 3300005805 | Lake | MKMISKYSRNIKKLLKEYHRKWDCFGNRRNKKKK* |
| Ga0079957_10372494 | 3300005805 | Lake | MTISGYKKAIAKLLKAYHKKWDCFGNERNKKKKKSK* |
| Ga0079957_10488716 | 3300005805 | Lake | MISKYKKAIAKLLKEYHKKWDCFGNERKKNGSKKSRT* |
| Ga0079957_10864237 | 3300005805 | Lake | MTISGYKKAIAKLLKAYHKKWDCFGKERKKNGSKKSRT* |
| Ga0079957_11241352 | 3300005805 | Lake | MTISGYKKAIARLLKAYKKKYDAFGNERKKKNGSKKS* |
| Ga0079957_11934454 | 3300005805 | Lake | CRTITMTISGYKKAIARLLKAYKKKYDAFGKERKNGSKKSRT* |
| Ga0075470_100651736 | 3300006030 | Aqueous | MTYTMYKKAIAKLLKAYHKKWNAFGEPRKKNGSKKSRT* |
| Ga0079301_10256382 | 3300006639 | Deep Subsurface | MTIAGYKKAIAKLLKAYHKKWDCFGNKKNGSKKSRT* |
| Ga0070749_104456542 | 3300006802 | Aqueous | MISKYKKAIAKLLKEYHKKWDCFGNERNKNESKKSRT* |
| Ga0070749_105325182 | 3300006802 | Aqueous | MTISGYKKAIAKLLKAYHKKWDCFGKKKNGSKKSRT* |
| Ga0075464_101439322 | 3300006805 | Aqueous | MTLTSYKKAIAKLLKAYHKKWDAFGKARKGKRRVKR* |
| Ga0075464_104928022 | 3300006805 | Aqueous | MTLTMYKKAMVKLLKAYHKKWDAFGKQRPKKRKRSK* |
| Ga0075464_105660633 | 3300006805 | Aqueous | MTISGYKKAISKLLKAYHKKWDCFGKKKNGSKKSRT* |
| Ga0079299_10070742 | 3300006862 | Deep Subsurface | MKNKYLKQIQKLLKSYHKKWDCFGNRKNEKKNKTR* |
| Ga0075473_104031412 | 3300006875 | Aqueous | MTYTNYKKAIAKLLKAYHKKWNAFGEPRKKNGSKKSRT* |
| Ga0079300_100209397 | 3300007162 | Deep Subsurface | MTVAGYKKAIAKLLKAYHKKWDCFGNKKNGSKKSRT* |
| Ga0079300_100694535 | 3300007162 | Deep Subsurface | MTISGYKKAIAKLLKAYHKKWDCFGNKKNGSKKSRT* |
| Ga0075458_100951144 | 3300007363 | Aqueous | MTFTNYKKAIAKLLKAYHKKYNAFGKERLKKRKR* |
| Ga0099848_12468521 | 3300007541 | Aqueous | MTISGYKKAIAKLLKAYHKKWDCFGRERKKNGSKKSRT* |
| Ga0110929_10146288 | 3300008072 | Water Bodies | MTMTQYKKAIAKLLKAYHKKWDCFGKRRKNGSKKS* |
| Ga0114347_100095418 | 3300008114 | Freshwater, Plankton | MTISGYKKAIARLLKAYKKKYDALGRERKNGSKKSRA* |
| Ga0114876_11227473 | 3300008448 | Freshwater Lake | MTMTQYKKTIAKLLKAYHKKWDCFGKEKKKNGSKKSRT* |
| Ga0114973_107163772 | 3300009068 | Freshwater Lake | MTISEYKKSIAKLLKAYHKKFDCFGKRKNGSKKK* |
| Ga0105103_109064021 | 3300009085 | Freshwater Sediment | MTFSNYKKAIARLLKAYHKKYDAFGKKKNGSKKSRA* |
| Ga0105091_105926633 | 3300009146 | Freshwater Sediment | MTITQYKKAIAKLLKAYHKKWNAFGEPVKKKNGSKKSRT* |
| Ga0114980_100006637 | 3300009152 | Freshwater Lake | MTMSGYRKAIIKLLKAYHKKYDAFGKQKPRKKKRSK* |
| Ga0114980_102072074 | 3300009152 | Freshwater Lake | MTLTNYKKAIAKLLKAYHKKWDAFGKAKKGKRRVKR* |
| Ga0114977_100468396 | 3300009158 | Freshwater Lake | MTLTSYKKAIAKLLKAYHKKWDAFGKAKKGKRRVKR* |
| Ga0114978_100970855 | 3300009159 | Freshwater Lake | MTQTSDKKAIDKLLKAYHKKWDAFGKQRPKKRKRSK* |
| Ga0114970_107687622 | 3300009163 | Freshwater Lake | MTISKYKKSIAKLLKAYHKKFDCFGKRKNVSKKT* |
| Ga0105102_100072956 | 3300009165 | Freshwater Sediment | MTFNNYKKTIAKLLKAYHKKYDCFGKKKNESKKSRA* |
| Ga0105102_100654202 | 3300009165 | Freshwater Sediment | MTFSNYKKTIARLLKAYHKKYDAFGKKKNGSKKSRA* |
| Ga0105104_100323672 | 3300009168 | Freshwater Sediment | MTFSNYKKAIARLLKAYHKKYDAFGKKKNGSKKSRT* |
| Ga0105104_100963466 | 3300009168 | Freshwater Sediment | MTFNNYKKTIAKLLKAYHKKYDCFGKKKNGSKKSRA* |
| Ga0105097_101498237 | 3300009169 | Freshwater Sediment | MTIAGYKKAIAKLLKAYHKKWNAFGEPVKKKNGSKKSR |
| Ga0105096_107862262 | 3300009170 | Freshwater Sediment | MTFSNYKKKIARLLKAYHKKYDAFGKKKNGSKKSRA* |
| Ga0129333_101155093 | 3300010354 | Freshwater To Marine Saline Gradient | MTISEYKKAIAKLLKAYHKKWDCFGRKRKKNGSKKSRT* |
| Ga0129333_102106964 | 3300010354 | Freshwater To Marine Saline Gradient | MTISGYKKAIARLLKAYKKKYDAFGKERKNGSKKSRT* |
| Ga0129333_108686922 | 3300010354 | Freshwater To Marine Saline Gradient | MTISQYKKAIAKLLKAYHKKWDCFGKEKKKNGSKKSRT* |
| Ga0129333_117263003 | 3300010354 | Freshwater To Marine Saline Gradient | MTISGYKKAISKLLKTYHKKWDCFGRERKKNGSKKSRT* |
| Ga0153699_120510 | 3300011338 | Freshwater | MTVSGYKKAIAKLLKAYHKKWDCFGKERKKNGSKKSRT* |
| Ga0164293_104505262 | 3300013004 | Freshwater | MTVSGYKRAIAKLLKAYHKKWDCFGNKKNGPKKSRT* |
| Ga0164293_108212152 | 3300013004 | Freshwater | MTISGYKKAIAKLLKAYHKKWDCFGKRKNGSKKSRT* |
| Ga0164292_103328813 | 3300013005 | Freshwater | MTITQYKKAIAKLLKAYHKKWDCFGKKKNGSKKSRT* |
| (restricted) Ga0172367_103341291 | 3300013126 | Freshwater | AMTVSGYKKAIAKLLKAYHKKWDCFGKERKKNGSKKS* |
| (restricted) Ga0172376_103141742 | 3300014720 | Freshwater | MTVSGYKKAIAKLLKAYHKKWDCFGKERKKNGSKKS* |
| (restricted) Ga0172376_103464772 | 3300014720 | Freshwater | MIISGYKKAIAKLLKTYHKKWDCFGNERNKKKKK* |
| (restricted) Ga0172376_104257432 | 3300014720 | Freshwater | MTISGYKKAIVKLLKAYHKKWDCFGNERNKKKKK* |
| Ga0119960_10980151 | 3300014811 | Aquatic | MTVSGYKRAIAKLLKAYRKKYDAFGKERPKKRKRTK* |
| Ga0181352_10286534 | 3300017747 | Freshwater Lake | MKANKYLKQIQKLLKSYHKKWDCFGNIKNEKKNKTR |
| Ga0181344_10889591 | 3300017754 | Freshwater Lake | NKDGTMTKSGYKKAIAKLLKAYHKKWDCFGKRKNGSKKSRT |
| Ga0181357_11325565 | 3300017777 | Freshwater Lake | MTVSGYKRAIAKLLKAYRKKYDAFGKERPKKRKRIKXYKIEDL |
| Ga0181355_12779924 | 3300017785 | Freshwater Lake | MTFTNYKKAIAKLLKAYHKKWDAFGNKKNGSKKSRT |
| Ga0181355_13408032 | 3300017785 | Freshwater Lake | MTISQYKKAIAKLLKAYHKKWDCFGKERKKNGSKKSRT |
| Ga0181359_11005491 | 3300019784 | Freshwater Lake | LMTITQYKKAIAKLLKAYHKKWDCFGKKKNGSKKSRT |
| Ga0181359_11328333 | 3300019784 | Freshwater Lake | MTVSGYKRAIAKLLKAYRKKYDAFGKERPKKRKRIK |
| Ga0194113_103082914 | 3300020074 | Freshwater Lake | MTISGYKKAIAKLLKAYHKKWDCFGKERKKNGSKKS |
| Ga0208364_10019645 | 3300020533 | Freshwater | MTVAGYKKAIAKLLKAYHKKWDCFGNKKNGSKKSRT |
| Ga0222714_104711182 | 3300021961 | Estuarine Water | MTIAGYKKAIAKLLKAYHKKWDCFGNKKNGSKKSRT |
| Ga0222714_106169402 | 3300021961 | Estuarine Water | MTVSGYKKAIAKLLKAYHKKWDCFGKERKKNGSKKSRT |
| Ga0222713_100845957 | 3300021962 | Estuarine Water | MTISGYKKAIAKLLKAYHKKWDCFGKERKKNGSKKSRT |
| Ga0222712_102540292 | 3300021963 | Estuarine Water | MTITQYKKAIAKLLKAYHKKWDCFGKKKNGSKKSRT |
| Ga0222712_104375673 | 3300021963 | Estuarine Water | MTISGYKKAIARLLKAYKKKYDALGRERKNGSKKSRT |
| Ga0181353_10654992 | 3300022179 | Freshwater Lake | MKNKYLKQIQKLLKSYHKKWDCFGNIKNEKKNKTR |
| Ga0181354_10221894 | 3300022190 | Freshwater Lake | MTLSSYKKAIAKLLKAYHKKWDCFGKKKNGSKKSRT |
| Ga0214923_1000232525 | 3300023179 | Freshwater | MTMTQYKKAIAKLLKAYHKKWDCFGKKRKNGSKKS |
| Ga0214923_104924392 | 3300023179 | Freshwater | MTLTNYKKAIAKLLKAYHKKWDAFGKARKGKRRVKR |
| Ga0255185_10073924 | 3300024490 | Freshwater | MTISGYKKAIAKLLKAYKKKYDAFGKERKNGSKKSRT |
| Ga0208916_102662263 | 3300025896 | Aqueous | MTLTSYKKAIAKLLKAYHKKWDAFGKARKGKRRVKR |
| Ga0209704_10087495 | 3300027693 | Freshwater Sediment | MTFNNYKKTIAKLLKAYHKKYDVFGKKKNGSKKSRT |
| Ga0209492_11662835 | 3300027721 | Freshwater Sediment | MTFTTYKKAIEKLLKAYHKKYDCFGKKKNGSKKSRT |
| (restricted) Ga0247836_10044008 | 3300027728 | Freshwater | MTVSGYKKAIAKLLKAYHKKWDCFGKERKKKNGRR |
| (restricted) Ga0247836_10309986 | 3300027728 | Freshwater | MIISGYKKAIAKLLKAYHKKWDCFGKERKKKNGNR |
| (restricted) Ga0247836_10563657 | 3300027728 | Freshwater | MTISGYKKAIAKLLKAYHKKWDCFGKERKKKNGRR |
| (restricted) Ga0247836_11372582 | 3300027728 | Freshwater | MTVSGYKKAIVKLLKAYHKKWDCFGKERKKKNGRR |
| (restricted) Ga0247833_10435735 | 3300027730 | Freshwater | MTISGYKKAIAKLLKAYHKKWDCFGKERKKKNGSR |
| (restricted) Ga0247833_10446815 | 3300027730 | Freshwater | MTISEYKKAIAKLLKAYHKKWDCFGKERKKKNGNR |
| (restricted) Ga0247833_10605791 | 3300027730 | Freshwater | NNGNAMTISGYKKAIAKLLKAYHKKWDAFGKKRKKKNGNR |
| Ga0209087_10012553 | 3300027734 | Freshwater Lake | MTLTSYKKAIAKLLKAYHKKWDAFGKAKKGKRRVKR |
| Ga0209296_12571504 | 3300027759 | Freshwater Lake | MTLTNYKKAIAKLLKAYHKKWDAFGKAKKGKRRVKR |
| Ga0209253_101513918 | 3300027900 | Freshwater Lake Sediment | MTISGYKKAIAKLLKSYHKKWDCFGKRKNGSKKSRT |
| (restricted) Ga0247834_10819133 | 3300027977 | Freshwater | MTISGYKKAIAKLLKAYHKKWDAFGKKRKKKNGNR |
| Ga0247723_10434294 | 3300028025 | Deep Subsurface Sediment | MTVSGYKKAIAKLLKAYHKKWDCFGNKKNGPKKSRT |
| (restricted) Ga0247842_101531456 | 3300029268 | Freshwater | MTVSGYKKAIAKLLKAYHKKWDCFGKERKKKNGNR |
| Ga0119944_10221661 | 3300029930 | Aquatic | MTISGYKKAIARLLKAYKKKYDAFGKERKNGSKKS |
| Ga0315907_1000349520 | 3300031758 | Freshwater | MTISGYKKAIARLLKAYKKKYDALGRERKNGSKKSRA |
| Ga0315909_106429692 | 3300031857 | Freshwater | MTMTQYKKAIAKLLKAYHKKWDCFGKEKKKNGSKKSRT |
| Ga0334979_0051510_768_878 | 3300033996 | Freshwater | MTVSGYKRAIAKLLKAYHKKWDCFGNKKNGPKKSRT |
| Ga0334998_0056995_984_1094 | 3300034019 | Freshwater | MTFTNYKKAIAKLLKAYHKKWDCFGKKKNGSKKSQT |
| Ga0334998_0210068_425_535 | 3300034019 | Freshwater | MTMSGYKRAIAKLLKAYHKKWDCFGNKKNGSKKSRT |
| Ga0310127_003447_3245_3361 | 3300034072 | Fracking Water | MTISGYKKAISKLLKAYHKKWDCFGKERKKNGSKKSRT |
| Ga0335010_0677066_403_510 | 3300034092 | Freshwater | TISGYKKSISKLLKAYHKKWDCFGKKKNGSKKTRT |
| Ga0335027_0745111_295_405 | 3300034101 | Freshwater | MTFNNYKKTIAKLLKAYHKKYDCFGKKKNGSKKSRT |
| Ga0335068_0577811_147_257 | 3300034116 | Freshwater | MTMTQYKKAIAKLLKAYHKKWDCFGKKKNGSKKPRT |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |