Basic Information | |
---|---|
Family ID | F105024 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 41 residues |
Representative Sequence | KTETSWIDELIKWENAHPEYKPFKEDKDSQRQQNLKENY |
Number of Associated Samples | 73 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 35.00 % |
% of genes near scaffold ends (potentially truncated) | 16.00 % |
% of genes from short scaffolds (< 2000 bps) | 64.00 % |
Associated GOLD sequencing projects | 64 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (42.000 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (17.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (40.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.87% β-sheet: 0.00% Coil/Unstructured: 73.13% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF01555 | N6_N4_Mtase | 9.00 |
PF13392 | HNH_3 | 4.00 |
PF07460 | NUMOD3 | 2.00 |
PF04851 | ResIII | 2.00 |
PF05433 | Rick_17kDa_Anti | 2.00 |
PF00145 | DNA_methylase | 1.00 |
PF07275 | ArdA | 1.00 |
PF01145 | Band_7 | 1.00 |
PF14236 | DUF4338 | 1.00 |
PF07230 | Portal_Gp20 | 1.00 |
PF02384 | N6_Mtase | 1.00 |
PF02086 | MethyltransfD12 | 1.00 |
PF00383 | dCMP_cyt_deam_1 | 1.00 |
PF12705 | PDDEXK_1 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 9.00 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 9.00 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 9.00 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.00 |
COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 1.00 |
COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 1.00 |
COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.00 % |
Unclassified | root | N/A | 16.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000126|BS_KBB_SWE26_205mDRAFT_c1063675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 584 | Open in IMG/M |
3300002144|M2t2BS2_10184769 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5027 | Open in IMG/M |
3300005581|Ga0049081_10042856 | All Organisms → Viruses → Predicted Viral | 1718 | Open in IMG/M |
3300005582|Ga0049080_10011972 | All Organisms → Viruses → Predicted Viral | 3007 | Open in IMG/M |
3300005805|Ga0079957_1048142 | All Organisms → Viruses → Predicted Viral | 2634 | Open in IMG/M |
3300005805|Ga0079957_1064105 | All Organisms → Viruses → Predicted Viral | 2160 | Open in IMG/M |
3300005940|Ga0073913_10006033 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
3300005941|Ga0070743_10003434 | Not Available | 5851 | Open in IMG/M |
3300006030|Ga0075470_10010711 | All Organisms → Viruses → Predicted Viral | 2827 | Open in IMG/M |
3300006030|Ga0075470_10070896 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
3300006641|Ga0075471_10091944 | Not Available | 1634 | Open in IMG/M |
3300006919|Ga0070746_10543807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 504 | Open in IMG/M |
3300007165|Ga0079302_1029595 | All Organisms → Viruses → Predicted Viral | 1336 | Open in IMG/M |
3300007538|Ga0099851_1140848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 902 | Open in IMG/M |
3300007538|Ga0099851_1196801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 735 | Open in IMG/M |
3300007539|Ga0099849_1031699 | All Organisms → Viruses → Predicted Viral | 2260 | Open in IMG/M |
3300007541|Ga0099848_1000273 | Not Available | 23121 | Open in IMG/M |
3300007542|Ga0099846_1061390 | All Organisms → Viruses → Predicted Viral | 1414 | Open in IMG/M |
3300007544|Ga0102861_1000809 | Not Available | 6610 | Open in IMG/M |
3300007544|Ga0102861_1001161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5515 | Open in IMG/M |
3300008110|Ga0114343_1188851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 610 | Open in IMG/M |
3300008113|Ga0114346_1019301 | All Organisms → Viruses → Predicted Viral | 3690 | Open in IMG/M |
3300008262|Ga0114337_1000103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 109541 | Open in IMG/M |
3300009001|Ga0102963_1202035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 792 | Open in IMG/M |
3300009075|Ga0105090_10188442 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
3300009081|Ga0105098_10736975 | Not Available | 526 | Open in IMG/M |
3300009085|Ga0105103_10012559 | All Organisms → Viruses → Predicted Viral | 4107 | Open in IMG/M |
3300009149|Ga0114918_10013907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 6289 | Open in IMG/M |
3300009149|Ga0114918_10031430 | All Organisms → Viruses → Predicted Viral | 3785 | Open in IMG/M |
3300009149|Ga0114918_10108486 | All Organisms → Viruses → Predicted Viral | 1712 | Open in IMG/M |
3300009149|Ga0114918_10153137 | All Organisms → Viruses → Predicted Viral | 1374 | Open in IMG/M |
3300009149|Ga0114918_10198418 | All Organisms → Viruses → Predicted Viral | 1167 | Open in IMG/M |
3300009149|Ga0114918_10468737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 678 | Open in IMG/M |
3300009149|Ga0114918_10601191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 582 | Open in IMG/M |
3300009152|Ga0114980_10134264 | All Organisms → Viruses → Predicted Viral | 1470 | Open in IMG/M |
3300009159|Ga0114978_10227328 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
3300009450|Ga0127391_1005486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Atlauavirus | 2800 | Open in IMG/M |
3300009450|Ga0127391_1036177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 985 | Open in IMG/M |
3300009451|Ga0127402_1006962 | All Organisms → Viruses → Predicted Viral | 3252 | Open in IMG/M |
3300009469|Ga0127401_1017986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2075 | Open in IMG/M |
3300009470|Ga0126447_1091289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 743 | Open in IMG/M |
3300009480|Ga0127405_1046013 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
3300009504|Ga0114946_10341202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 784 | Open in IMG/M |
3300010297|Ga0129345_1259932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 606 | Open in IMG/M |
3300010297|Ga0129345_1293161 | Not Available | 564 | Open in IMG/M |
3300010297|Ga0129345_1310761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 545 | Open in IMG/M |
3300010300|Ga0129351_1180585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 824 | Open in IMG/M |
3300010354|Ga0129333_10565317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 990 | Open in IMG/M |
3300011268|Ga0151620_1061720 | All Organisms → Viruses → Predicted Viral | 1219 | Open in IMG/M |
3300018610|Ga0188884_1011090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 591 | Open in IMG/M |
3300018682|Ga0188851_1030540 | Not Available | 595 | Open in IMG/M |
3300019096|Ga0188835_1007928 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 961 | Open in IMG/M |
3300019122|Ga0188839_1022121 | Not Available | 655 | Open in IMG/M |
3300020141|Ga0211732_1261956 | All Organisms → Viruses → Predicted Viral | 1562 | Open in IMG/M |
3300020141|Ga0211732_1289246 | All Organisms → Viruses → Predicted Viral | 2579 | Open in IMG/M |
3300020141|Ga0211732_1461415 | All Organisms → Viruses → Predicted Viral | 4102 | Open in IMG/M |
3300020151|Ga0211736_10058195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7435 | Open in IMG/M |
3300020151|Ga0211736_10455373 | All Organisms → Viruses → Predicted Viral | 4249 | Open in IMG/M |
3300020159|Ga0211734_10096730 | Not Available | 693 | Open in IMG/M |
3300020160|Ga0211733_11224329 | Not Available | 530 | Open in IMG/M |
3300020161|Ga0211726_10289051 | All Organisms → Viruses → Predicted Viral | 1350 | Open in IMG/M |
3300020172|Ga0211729_10002511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 700 | Open in IMG/M |
3300020172|Ga0211729_10835499 | All Organisms → Viruses → Predicted Viral | 1519 | Open in IMG/M |
3300020172|Ga0211729_11237301 | Not Available | 520 | Open in IMG/M |
3300020205|Ga0211731_11097026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 820 | Open in IMG/M |
3300021373|Ga0213865_10117692 | All Organisms → Viruses → Predicted Viral | 1396 | Open in IMG/M |
3300021373|Ga0213865_10464625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 547 | Open in IMG/M |
3300021425|Ga0213866_10008033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6613 | Open in IMG/M |
3300021425|Ga0213866_10008417 | Not Available | 6446 | Open in IMG/M |
3300021425|Ga0213866_10075212 | All Organisms → Viruses → Predicted Viral | 1872 | Open in IMG/M |
3300021961|Ga0222714_10617023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 539 | Open in IMG/M |
3300022198|Ga0196905_1151293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 597 | Open in IMG/M |
3300024262|Ga0210003_1005813 | All Organisms → cellular organisms → Bacteria | 9367 | Open in IMG/M |
3300024262|Ga0210003_1008206 | Not Available | 7513 | Open in IMG/M |
3300024262|Ga0210003_1243964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 713 | Open in IMG/M |
3300024346|Ga0244775_10000481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 49235 | Open in IMG/M |
3300025585|Ga0208546_1028332 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
3300025585|Ga0208546_1135567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 532 | Open in IMG/M |
3300025646|Ga0208161_1005424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 5862 | Open in IMG/M |
3300025674|Ga0208162_1025786 | All Organisms → Viruses → Predicted Viral | 2203 | Open in IMG/M |
3300025732|Ga0208784_1000023 | All Organisms → Viruses | 65833 | Open in IMG/M |
3300025732|Ga0208784_1001300 | Not Available | 10588 | Open in IMG/M |
3300025889|Ga0208644_1307976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 625 | Open in IMG/M |
3300027114|Ga0208009_1055566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 726 | Open in IMG/M |
3300027205|Ga0208926_1000411 | All Organisms → cellular organisms → Bacteria | 7679 | Open in IMG/M |
3300027205|Ga0208926_1001817 | All Organisms → Viruses → Predicted Viral | 3124 | Open in IMG/M |
3300027224|Ga0208164_1025600 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
3300027675|Ga0209077_1054520 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
3300027763|Ga0209088_10027545 | All Organisms → Viruses → Predicted Viral | 2883 | Open in IMG/M |
3300027940|Ga0209893_1005919 | Not Available | 856 | Open in IMG/M |
3300027972|Ga0209079_10010959 | All Organisms → Viruses → Predicted Viral | 3021 | Open in IMG/M |
3300027975|Ga0209391_10407485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 521 | Open in IMG/M |
3300031746|Ga0315293_10698325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 755 | Open in IMG/M |
3300031746|Ga0315293_11268385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 508 | Open in IMG/M |
3300031951|Ga0315904_10068982 | All Organisms → Viruses → Predicted Viral | 3840 | Open in IMG/M |
3300031999|Ga0315274_11653345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-B05 | 598 | Open in IMG/M |
3300032173|Ga0315268_11373363 | Not Available | 717 | Open in IMG/M |
3300033521|Ga0316616_103046267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 631 | Open in IMG/M |
3300033557|Ga0316617_101583381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 663 | Open in IMG/M |
3300034082|Ga0335020_0106549 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 17.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.00% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 10.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.00% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 6.00% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.00% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.00% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 4.00% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.00% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.00% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.00% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 2.00% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.00% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 2.00% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.00% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.00% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.00% |
Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 1.00% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.00% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.00% |
Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000126 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 26_20.5m | Environmental | Open in IMG/M |
3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009451 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009480 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 10m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009504 | Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment | Environmental | Open in IMG/M |
3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300018610 | Metatranscriptome of marine microbial communities from Baltic Sea - LD35M_ls2 | Environmental | Open in IMG/M |
3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
3300019096 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1 | Environmental | Open in IMG/M |
3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027205 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027224 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 (SPAdes) | Environmental | Open in IMG/M |
3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
BS_KBB_SWE26_205mDRAFT_10636751 | 3300000126 | Marine | MSKTNTKSSWIDELIKWENAHPEYKPFKEDKDSQRQQNSKENY* |
M2t2BS2_101847695 | 3300002144 | Marine | MSKTETSWIDELIKWENAHPEYEPFKEDNNSQRQQNLKENY* |
Ga0049081_100428564 | 3300005581 | Freshwater Lentic | MDDSWIDELIKWENAHPEYEPFKEDKDSQRQENTKENY* |
Ga0049080_100119725 | 3300005582 | Freshwater Lentic | MDDSWIDELIKWENAHPEYEPFKEDKDSQREQNTKENY* |
Ga0079957_10481429 | 3300005805 | Lake | MMKTETSWIDELIKWENAHPEYKPFQEDKDSQRQQNLKENY* |
Ga0079957_10641056 | 3300005805 | Lake | MKNETSWIDELIKWENAHPEYKPFQEDKDSQRQQNLKENY* |
Ga0073913_100060333 | 3300005940 | Sand | MDKTETSWIDELIRWENSHPEYKPFKEDSDSQRQLNSQENY* |
Ga0070743_100034342 | 3300005941 | Estuarine | MTSPSTDKQSSWIDELIRWENSHPEYKPFKEDKDSQRQENLKENF* |
Ga0075470_1001071110 | 3300006030 | Aqueous | MKTNSNSSWIDELIKWENAHPEYQPFEEDENSQRRQNQKEDY* |
Ga0075470_100708965 | 3300006030 | Aqueous | MKKTNSNSSWIDELIKWENAHPEYKPFKEDEDSQRRQNQKETY* |
Ga0075471_100919444 | 3300006641 | Aqueous | MNTQPKEQSSWIDELIKWENAHPEHKPFKEDNNSQRQQNLKETY* |
Ga0070746_105438071 | 3300006919 | Aqueous | MSKTETSWIDELIKWENAHPEYKPFKEDKDSQRQQNLKENY* |
Ga0079302_10295954 | 3300007165 | Deep Subsurface | MDDSWIDELIKWENAHPEYEPFKEDKDSQRQENLKENF* |
Ga0099851_11408481 | 3300007538 | Aqueous | MTTKSNQNTSWTEELMKWYNTHPEYKPFTEDKDSQRQQNQKETY* |
Ga0099851_11968013 | 3300007538 | Aqueous | MTDSWIDELIKWENAHPEYEPFKEDNDSQRQENLKENY* |
Ga0099849_10316992 | 3300007539 | Aqueous | MSKTNSKSSWIDELIKWENAHPEYKPFKEDKDSQRQQNLKENY* |
Ga0099848_100027322 | 3300007541 | Aqueous | MKQQKPSQSSWIDELIRWENAHPEYKPFKEDSDSQRQQNLKETY* |
Ga0099846_10613902 | 3300007542 | Aqueous | MYKTETSWIDELIKWENAHPEYKPFKEDKDSQRQQNLKENY* |
Ga0102861_10008093 | 3300007544 | Estuarine | MKNETSWIDELIKWENAHPEYEPFKEDKDSQRQQNTKENY* |
Ga0102861_10011613 | 3300007544 | Estuarine | MDDSWIDELIKWENAHPEYEPFKEDKDSQRQENLKENY* |
Ga0114343_11888513 | 3300008110 | Freshwater, Plankton | MTKTNSNSSWIDELIKWENAHPEYKPFKEDKDSQRQQNQKETY* |
Ga0114346_10193019 | 3300008113 | Freshwater, Plankton | MKTNSNSSWIDELIKWENAHPEYKPFKEDEDSQRQQNQKEDY* |
Ga0114337_1000103133 | 3300008262 | Freshwater, Plankton | MNTQPKSQSSWIDELIRWENAHPEYKPFREDEDSQRRQNTKENY* |
Ga0102963_12020354 | 3300009001 | Pond Water | MSKTETSWIDELIKWENAHPEYKPFKEDKDSQRQQNL |
Ga0105090_101884424 | 3300009075 | Freshwater Sediment | MMKTKTSWIDELIKWENAHPEYKPFKENKDSQRQQNTKENY* |
Ga0105098_107369752 | 3300009081 | Freshwater Sediment | MMKTKTSWIDELIKWENAHPEYQPFEEDKDSQRRQNLKENY* |
Ga0105103_100125594 | 3300009085 | Freshwater Sediment | MMKTKTSWIDELIKWENAHPEYKPFKEDKDSQRQQNTKENY* |
Ga0114918_100139078 | 3300009149 | Deep Subsurface | MKNETSWIDELIKWENAHPEYEPFKEDKDSQRQENTKENY* |
Ga0114918_100314304 | 3300009149 | Deep Subsurface | MDDSWIDELIKWENAHPEYEPFKEDKDSQRQENAKENY* |
Ga0114918_101084866 | 3300009149 | Deep Subsurface | MSKTESSWIDELIKWENAHPEYKPFKEDKDSQRQQN |
Ga0114918_101531372 | 3300009149 | Deep Subsurface | MTQKQSKSSWIDELIKWENAHPEYKPFKEDKDSQRQQNLKENY* |
Ga0114918_101984183 | 3300009149 | Deep Subsurface | MTSPSTDKQSSWIDELIKWENSHPEYKPFKEDKDSQRQQNLKENF* |
Ga0114918_104687372 | 3300009149 | Deep Subsurface | MTSPSTDKQSSWIDELIKWENAHPEYKPFKEDKDSQRQQNLKENF* |
Ga0114918_106011913 | 3300009149 | Deep Subsurface | STELPMDDSWIDELIKWENAHPEYEPFKEDKDSQREENTKENY* |
Ga0114980_101342645 | 3300009152 | Freshwater Lake | MTSSSIDKQSSWIDELIKWENTHPEYKPFKEDNDSQHQQNQKENY* |
Ga0114978_102273281 | 3300009159 | Freshwater Lake | MTSSSIDKQSSWIDELIKWENTHPEYKPFKEDNDSQRQQNQKENY* |
Ga0127391_10054864 | 3300009450 | Meromictic Pond | MSKTESSWIDELIKWENAHPEYKPFKEDKDSQRQQNSKENY* |
Ga0127391_10361771 | 3300009450 | Meromictic Pond | MDNSWIDELIKWENAHPEYEPFKEDNDSQRQENLKENY* |
Ga0127402_10069627 | 3300009451 | Meromictic Pond | MTSPSTNKQSSWIDELIRWENSHPEYKPFKEDKDSQRQENLKENF* |
Ga0127401_10179862 | 3300009469 | Meromictic Pond | MKTNSNSSWVDELIKWENAHPEYKPFKEDNNSQRQQNLKENY* |
Ga0126447_10912893 | 3300009470 | Meromictic Pond | MTHKELPSWIDELIRWENSHPEYKPFKEDKDSQRQENLKENF* |
Ga0127405_10460132 | 3300009480 | Meromictic Pond | MTDSWIDELIKWENAHPEYEPFKEDKDSQRQENLKENY* |
Ga0114946_103412022 | 3300009504 | Sediment | MTSKQSSWIDELIKWENAHPEYKPFKEDKDSQRQQNIKEKF* |
Ga0129345_12599321 | 3300010297 | Freshwater To Marine Saline Gradient | MNTQPMTSSSTDKQSSWIDELIKWENAHPEYKPFKEDKDSQRQ |
Ga0129345_12931612 | 3300010297 | Freshwater To Marine Saline Gradient | MSKTETSWIDELIKWENAHPEYEPFKEDKDSQRQQNLKENY* |
Ga0129345_13107612 | 3300010297 | Freshwater To Marine Saline Gradient | WIDELIKWENAHPEYEPFKEDNDSQRQENLKENY* |
Ga0129351_11805854 | 3300010300 | Freshwater To Marine Saline Gradient | SWIDELIKWENAHPEYEPFKEDKDSQRQENLKENY* |
Ga0129333_105653175 | 3300010354 | Freshwater To Marine Saline Gradient | MNTQPKSQSSWIDELIKWENAHPEYKPFKEDEDSQRRQNTKENY* |
Ga0151620_10617205 | 3300011268 | Freshwater | MSKTETSWIDELIKWENSHPEYEPFKEDKDSQRQQ |
Ga0188884_10110902 | 3300018610 | Freshwater Lake | MDDSWIDELIKWENAHPEYEPFKEDKDSQREENTKENY |
Ga0188851_10305402 | 3300018682 | Freshwater Lake | MKTETSWIDELIKWENAHPEYKPFQEDKDSQRQQNTKENY |
Ga0188835_10079283 | 3300019096 | Freshwater Lake | MKTETSWIDELIKWENAHPEYKPFKEDKDSQRQLNTKENY |
Ga0188839_10221211 | 3300019122 | Freshwater Lake | MKTETSWIDELIKWENAHPEYQPFQEDKDSQRQQNTKENY |
Ga0211732_12619562 | 3300020141 | Freshwater | MSKTETSWIDELIKWENAHPEYKPFKEDKDSQRQQNLKENY |
Ga0211732_12892464 | 3300020141 | Freshwater | MKTQSKTETSWIDELIKWENAHPEYKPFQEDKDSQRQQNFKENY |
Ga0211732_14614152 | 3300020141 | Freshwater | MMKTKTSWIDELIKWENAHPEYKPFQEDKDSQRQQNTKDKY |
Ga0211736_100581952 | 3300020151 | Freshwater | MTDSWIDELIKWENAHPEYEPFKEDKDSQREQNTKENY |
Ga0211736_1045537313 | 3300020151 | Freshwater | MAIETSWIDELIKWENAHPEYKPFQEDKDSQRQQNTKENY |
Ga0211734_100967302 | 3300020159 | Freshwater | MTDSWIDELIKWENAHPEYKPFQEDKDSQRQQNFKENY |
Ga0211733_112243292 | 3300020160 | Freshwater | SVRVTEMKTQSKTETSWIDELIKWENAHPEYKPFQEDKDSQRQQNFKENY |
Ga0211726_102890513 | 3300020161 | Freshwater | MMKTKTSWIDELIKWENAHPEYKPFQEDKDSQRQQNTKD |
Ga0211729_100025113 | 3300020172 | Freshwater | MNDSWIDELIKWENAHPEYEPFKEDKDSQREQNTKENY |
Ga0211729_108354992 | 3300020172 | Freshwater | MNTKSKTKSSWIDELIKWENAHPEYEPFKEDKDSQRQQNSKENY |
Ga0211729_112373011 | 3300020172 | Freshwater | MKTKSSWIDELIKWENAHPEYKPFKEDKNSQRQQNTKENY |
Ga0211731_110970262 | 3300020205 | Freshwater | MDDSWIDELIKWENAHPEYEPFKEDKDSQREQNTKENY |
Ga0213865_101176922 | 3300021373 | Seawater | MTDSWIDELIKWENAHPEYEPFKEDKDSQRQENLKENY |
Ga0213865_104646252 | 3300021373 | Seawater | MSKTNSKSSWIDELIKWENAHPEYKPFKEDKDSQRQQNLKENY |
Ga0213866_100080339 | 3300021425 | Seawater | MYKTETSWIDELIKWENAHPEYKPFKEDKDSQRQQNLKENY |
Ga0213866_100084171 | 3300021425 | Seawater | MDNSWIDELIKWENAHPEYEPFKEDNDSQRQENLKENY |
Ga0213866_100752121 | 3300021425 | Seawater | KTETSWIDELIKWENAHPEYKPFKEDKDSQRQQNLKENY |
Ga0222714_106170232 | 3300021961 | Estuarine Water | MSKTETSWIDELIKWENAHPEYKPFKEDSDSQRQQNLKETY |
Ga0196905_11512931 | 3300022198 | Aqueous | MTTKSNQNTSWTEELMKWYNTHPEYKPFTEDKDSQRQQNQKETY |
Ga0210003_10058135 | 3300024262 | Deep Subsurface | MDDSWIDELIKWENAHPEYEPFKEDKDSQRQENAKENY |
Ga0210003_10082067 | 3300024262 | Deep Subsurface | MTSPSTDKQSSWIDELIKWENSHPEYKPFKEDKDSQRQQNLKENF |
Ga0210003_12439642 | 3300024262 | Deep Subsurface | MTSPSTDKQSSWIDELIKWENAHPEYKPFKEDKDSQRQQNLKENF |
Ga0244775_10000481118 | 3300024346 | Estuarine | MTSPSTDKQSSWIDELIRWENSHPEYKPFKEDKDSQRQENLKENF |
Ga0208546_10283322 | 3300025585 | Aqueous | MKTNSNSSWIDELIKWENAHPEYQPFEEDENSQRRQNQKEDY |
Ga0208546_11355671 | 3300025585 | Aqueous | MKKTNSNSSWIDELIKWENAHPEYKPFKEDEDSQRRQNQKETYXLXL |
Ga0208161_100542412 | 3300025646 | Aqueous | MKQQKPSQSSWIDELIRWENAHPEYKPFKEDSDSQRQQNLKETY |
Ga0208162_10257864 | 3300025674 | Aqueous | MTDSWIDELIKWENAHPEYEPFKEDNDSQRQENLKENY |
Ga0208784_100002351 | 3300025732 | Aqueous | MKKTNSNSSWIDELIKWENAHPEYKPFKEDEDSQRRQNQKETY |
Ga0208784_10013007 | 3300025732 | Aqueous | MNTQPKEQSSWIDELIKWENAHPEHKPFKEDNNSQRQQNLKETY |
Ga0208644_13079763 | 3300025889 | Aqueous | LQLSRMMTKTNQNSSWIDELIKWENAHPEYKPFTEDENSQRRQNQKEDY |
Ga0208009_10555661 | 3300027114 | Deep Subsurface | SWIDELIKWENAHPEYEPFKEDKDSQREQNLKENF |
Ga0208926_100041112 | 3300027205 | Estuarine | MKNETSWIDELIKWENAHPEYEPFKEDKDSQRQQNTKENY |
Ga0208926_10018177 | 3300027205 | Estuarine | MDDSWIDELIKWENAHPEYEPFKEDKDSQRQENLKENY |
Ga0208164_10256001 | 3300027224 | Estuarine | RTPPMDDSWIDELIKWENAHPEYEPFKEDKDSQRQENLKENY |
Ga0209077_10545203 | 3300027675 | Freshwater Sediment | MKTKTSWIDELIKWENAHPEYKPFKEDKDSQRQQNTKENY |
Ga0209088_100275457 | 3300027763 | Freshwater Lake | MTSSSIDKQSSWIDELIKWENTHPEYKPFKEDNDSQRQQNQKENY |
Ga0209893_10059191 | 3300027940 | Sand | MDKTETSWIDELIRWENSHPEYKPFKEDSDSQRQLNSQENY |
Ga0209079_100109592 | 3300027972 | Freshwater Sediment | MMKTKTSWIDELIKWENAHPEYKPFKEDKDSQRQQNTKENY |
Ga0209391_104074851 | 3300027975 | Freshwater Sediment | RSHSQTAASGGMMKTKTSWIDELIKWENAHPEYKPFKENKDSQRQQNTKENY |
Ga0315293_106983251 | 3300031746 | Sediment | NVLGQEDWVNELVKWENAHPEYTPFQEDKDSQRQQNTKQI |
Ga0315293_112683852 | 3300031746 | Sediment | MSKTETSWIDELIKWENAHPEYKPFKEDKDSQRQQNSKENY |
Ga0315904_1006898211 | 3300031951 | Freshwater | MKTNSNSSWIDELIKWENAHPEYKPFKEDEDSQRQQNQKEDY |
Ga0315274_116533452 | 3300031999 | Sediment | MTKTETSWIDELIKWENAHPEYEPFKEDKDSQRQENTKENY |
Ga0315268_113733631 | 3300032173 | Sediment | MPIETSWIDELIKWENAHPEYKPFQEDKDSQRQQNTKENY |
Ga0316616_1030462673 | 3300033521 | Soil | MMTKTNQNSSWIDELIKWENAHPEYKPFTEDENSQRQQNQKEDY |
Ga0316617_1015833813 | 3300033557 | Soil | MKTNSNSSWIDELIKWENAHPEYKPFKEDEDSQRRQNQKEDY |
Ga0335020_0106549_398_520 | 3300034082 | Freshwater | MKNETSWIDELIKWENAHPEYEPFKEDKDSQRQENTKENY |
⦗Top⦘ |